SecReT4
Protein ID: 161617495
T4SS name [ID]Tfc [713]
Gene symbol-
Locus tagSPAB_05354
StrainSalmonella enterica subsp. enterica serovar Paratyphi B str. SPB7
Repliconchromosome [GenBank: NC_010102] [Browse all T4SS(s) in this replicon]
Location [Strand]4506036..4507385 [+]
Producthypothetical protein
Component typeTfc2
UniProt IDA9N2U7
KEGG IDspq:SPAB_05354
PDB IDNA
Domain hit(s) vs Pfam TcpQ [PF10671], Evalue: 2.6e-20, Aligned region: 356..446
Protein Sequence: 449 a.a.     [Download]
>gi|161617495|ref|YP_001591461.1| hypothetical protein SPAB_05354 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
MVKINLQTRYRLGAITLCLLAAGCTDFSSRSEPMSRLQGSPRVQDLYQNRSPEVVRYDRYTLASTRPVDA
QRDPLNQIIDIKMPLQMVNTIGEGMRYVMLESGYSLCSGEPGVFSELFVKPLPAVQRSLGPVKLGDALQI
LAGPAWRMRVDDLNREICFVQRDEYRHLALSTTGPLQASVASQGTGKSASTGTLLNSSKGLSGTGNNSYP
LPPARPESSILSPGTPKVTSQAVSPLSVATTAKTPRNPFSASESGEKSTVPVQKTQAGPAAKLTSGKVKP
STELAPAPAPSALSVASAPLNKAALGVPLTSSGAVKPGGTVQNSNPPSTVISRTAPVSGKTVFTPGALLS
SLPDGQAWTAQAGTTLKETLIQWATSVRCESGSSPTWVVIWPTPVNYRIDVPFTLRGNFESIIVQLFRLY
RPAEKPLYAAPNRLQCLVFVDDKPIQDGK
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|161612313|ref|NC_010102.1|:4506036-4507385 Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7 chromosome, complete genome
ATGGTAAAAATAAACCTGCAGACACGTTATCGGCTTGGGGCCATCACGCTATGTCTGCTTGCCGCTGGCT
GCACAGACTTTAGTTCTCGCTCTGAACCTATGAGCAGGCTTCAGGGCTCTCCCCGTGTTCAGGACCTTTA
TCAAAACCGTTCCCCTGAAGTTGTTCGATACGATCGTTACACACTTGCGAGTACGCGACCTGTAGATGCT
CAGCGTGACCCACTGAATCAGATTATCGATATCAAGATGCCTTTGCAGATGGTGAATACCATTGGGGAAG
GTATGCGATACGTGATGCTTGAATCAGGTTATTCACTGTGTTCAGGCGAACCGGGTGTATTCTCTGAATT
GTTCGTTAAACCATTACCGGCTGTGCAGCGTTCATTAGGACCTGTGAAGCTTGGAGATGCTTTACAAATC
CTGGCCGGGCCTGCCTGGCGTATGCGCGTAGATGACCTAAATCGAGAAATTTGTTTCGTTCAGCGTGATG
AATATCGACATCTTGCCCTCTCAACAACAGGTCCCTTGCAGGCGAGTGTAGCAAGTCAGGGAACAGGGAA
ATCTGCTTCTACAGGCACACTACTTAACAGTTCTAAGGGACTTTCTGGTACTGGAAATAATAGCTATCCG
TTGCCTCCGGCTCGGCCAGAAAGTTCCATTTTGTCACCAGGGACACCAAAAGTTACCTCTCAAGCTGTTT
CTCCTTTATCTGTTGCAACGACAGCAAAAACACCTCGTAACCCGTTCTCTGCCAGCGAGTCTGGGGAAAA
ATCTACGGTTCCGGTGCAGAAAACACAGGCAGGTCCCGCAGCTAAGTTAACATCTGGCAAAGTAAAACCA
TCAACAGAGTTGGCTCCTGCGCCTGCGCCGTCAGCATTGTCAGTTGCGTCAGCACCTCTGAATAAAGCTG
CTCTTGGTGTTCCTTTAACTTCATCTGGTGCAGTGAAACCAGGTGGAACGGTTCAGAACAGTAATCCACC
TTCAACGGTCATCTCTCGTACTGCTCCGGTCAGCGGAAAAACTGTTTTCACTCCGGGAGCATTGCTTTCC
TCGTTACCAGACGGACAGGCCTGGACCGCGCAGGCAGGCACTACGTTAAAAGAGACTCTGATCCAATGGG
CTACATCGGTTCGCTGTGAGAGTGGCAGTAGTCCTACCTGGGTAGTTATCTGGCCAACGCCTGTGAACTA
CCGCATCGATGTACCATTTACGCTGCGCGGTAATTTCGAGTCGATTATCGTGCAGCTGTTTAGGTTATAT
CGCCCTGCAGAAAAACCCCTCTATGCAGCACCAAATCGTCTTCAGTGCCTGGTATTCGTGGACGATAAGC
CGATTCAGGACGGGAAATGA
 Primer design