SecReT4
Protein ID: 161617512
T4SS name [ID]Tfc [713]
Gene symbol-
Locus tagSPAB_05371
StrainSalmonella enterica subsp. enterica serovar Paratyphi B str. SPB7
Repliconchromosome [GenBank: NC_010102] [Browse all T4SS(s) in this replicon]
Location [Strand]4520756..4521379 [+]
Producthypothetical protein
Component typeTfc4
UniProt IDA9N2W3
KEGG IDspq:SPAB_05371
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 207 a.a.     [Download]
>gi|161617512|ref|YP_001591477.1| hypothetical protein SPAB_05371 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
MANCRILKLACCLWFVSTGCLAVVNVNSSVQVVPQAYRIIAAAERVPAESLYSLAMAESTRKTAWGSKPW
PWTINVAGKGYHFETREEAFAALLGFMQRYPLKRIDVGVAQVNLGWNGHLFPSFRDAFDPYTNLRAAARI
LRACYDAQPGSWIKAAGCYHHPAGGKPAAKYMAIVRRKLSQIAPDIKVPEGEPVALASHSLTWVEPQ
 
Nucleotide Sequence: 624 bp     [Download]
>gi|161612313|ref|NC_010102.1|:4520756-4521379 Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7 chromosome, complete genome
ATGGCAAATTGCCGCATTCTGAAACTGGCTTGCTGTTTATGGTTTGTCAGCACTGGTTGCCTGGCGGTCG
TGAATGTAAATAGCAGTGTTCAGGTAGTTCCGCAGGCTTATCGGATCATTGCTGCTGCCGAGCGCGTTCC
GGCAGAATCGCTTTACTCGCTGGCGATGGCCGAAAGCACCCGTAAAACCGCATGGGGGTCTAAACCATGG
CCCTGGACTATTAATGTAGCAGGGAAAGGATACCACTTTGAAACCCGCGAGGAGGCCTTTGCGGCACTTC
TTGGATTTATGCAGCGCTACCCTCTCAAGCGTATCGATGTCGGTGTAGCCCAGGTCAATCTTGGGTGGAA
CGGGCATCTTTTCCCATCCTTTCGTGATGCTTTTGATCCCTACACAAATCTTCGTGCAGCGGCCCGAATT
CTCCGTGCCTGCTATGACGCTCAGCCTGGAAGCTGGATTAAAGCTGCTGGCTGTTATCACCACCCGGCCG
GTGGTAAGCCGGCAGCAAAATATATGGCTATCGTACGCCGTAAGCTAAGTCAGATCGCACCTGATATTAA
GGTCCCTGAAGGGGAGCCGGTTGCTCTGGCCAGTCACTCATTAACCTGGGTTGAACCTCAATGA
 Primer design