SecReT4
Protein ID: 161617513
T4SS name [ID]Tfc [713]
Gene symbol-
Locus tagSPAB_05372
StrainSalmonella enterica subsp. enterica serovar Paratyphi B str. SPB7
Repliconchromosome [GenBank: NC_010102] [Browse all T4SS(s) in this replicon]
Location [Strand]4521376..4521906 [+]
Producthypothetical protein
Component typeTfc5
UniProt IDA9N2W4
KEGG IDspq:SPAB_05372
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 6.9e-47, Aligned region: 31..174
Protein Sequence: 176 a.a.     [Download]
>gi|161617513|ref|YP_001591478.1| hypothetical protein SPAB_05372 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
MKKNIDKYFNGIFCVSLLTAAFSCFASLTVVGDLGGESTRPFFEAINSGEESHLSDVSSLPEPPSSLSIS
DMLPVNTPEMTPGKVTSRPLQLPGLPPVFVIGDDDISRAWLRQRGAELKGMGATGMVVNVTTESALNTLR
GLLPGTEMVPVRGGDLAQRLNLTHYPVLITADGLAQ
 
Nucleotide Sequence: 531 bp     [Download]
>gi|161612313|ref|NC_010102.1|:4521376-4521906 Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7 chromosome, complete genome
ATGAAAAAAAATATCGATAAATATTTCAATGGCATCTTTTGTGTATCACTGCTTACAGCAGCGTTTAGTT
GTTTTGCTTCGCTGACAGTGGTCGGGGATCTGGGCGGGGAGTCAACCAGACCATTTTTCGAGGCGATTAA
TTCAGGTGAAGAGTCGCATTTGTCCGATGTTTCCTCCTTGCCTGAACCACCGTCATCGCTGTCTATTTCC
GATATGTTGCCCGTTAATACACCGGAAATGACACCCGGAAAGGTGACGTCTCGCCCTCTGCAGTTACCCG
GTTTGCCCCCTGTTTTTGTGATTGGCGATGATGATATTTCCCGAGCCTGGCTGCGGCAGCGTGGTGCTGA
ACTGAAAGGGATGGGCGCCACAGGAATGGTAGTGAATGTTACGACTGAAAGTGCGCTCAATACGCTTAGA
GGACTCTTGCCAGGTACTGAGATGGTCCCTGTTCGCGGCGGTGATTTGGCACAGCGATTGAATCTGACGC
ATTACCCTGTCCTGATTACCGCTGATGGATTAGCGCAATGA
 Primer design