SecReT4
Protein ID: 161617517
T4SS name [ID]Tfc [713]
Gene symbol-
Locus tagSPAB_05376
StrainSalmonella enterica subsp. enterica serovar Paratyphi B str. SPB7
Repliconchromosome [GenBank: NC_010102] [Browse all T4SS(s) in this replicon]
Location [Strand]4524851..4525540 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDA9N2W8
KEGG IDspq:SPAB_05376
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 7.5e-68, Aligned region: 28..226
Protein Sequence: 229 a.a.     [Download]
>gi|161617517|ref|YP_001591482.1| hypothetical protein SPAB_05376 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
MLLWDLPVSLIGILLGSLLVSLLIEYACIAILWPDEGASHSYRVMVAESHWLSEGYTRSLLMAAPVETIS
RWVHTAWNWLFVDSGFSHWLQSFRETGQKGTGVIPTINRFGDSLIGWLGEYLQATLWVTLIFFIRVMILF
LSLPLFGLVIITGIVEGLVRRDLRRYGAGYESSFVYHHAKRFIKPALYGPCMLYLAWPTAVWPNLLLLPS
ALLLGGVLAIVTASFKKYL
 
Nucleotide Sequence: 690 bp     [Download]
>gi|161612313|ref|NC_010102.1|:4524851-4525540 Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7 chromosome, complete genome
ATGTTGCTCTGGGATTTGCCTGTCAGTTTAATTGGCATTCTGCTGGGGTCGCTTCTGGTTAGCCTGCTGA
TCGAATATGCCTGCATTGCCATACTCTGGCCTGACGAAGGTGCTTCACACAGCTACCGGGTGATGGTTGC
AGAAAGCCACTGGTTGTCGGAAGGGTACACGCGGAGTTTACTGATGGCAGCGCCGGTTGAGACGATTTCG
CGGTGGGTACATACCGCCTGGAACTGGTTGTTTGTCGATAGCGGATTCAGCCATTGGCTTCAATCATTCA
GGGAAACTGGTCAGAAGGGGACTGGAGTTATCCCAACGATAAACCGGTTCGGTGACTCACTAATCGGCTG
GCTTGGGGAGTACCTGCAAGCTACGCTCTGGGTAACTCTGATTTTCTTCATCAGGGTGATGATCCTTTTT
CTGAGTCTGCCGCTGTTCGGCCTGGTGATTATCACCGGCATAGTTGAAGGGCTGGTCCGTCGAGATTTGC
GTCGTTACGGAGCTGGATATGAATCGAGCTTTGTCTACCATCACGCCAAACGTTTTATTAAACCCGCACT
TTACGGCCCCTGCATGTTGTATCTGGCCTGGCCGACTGCTGTCTGGCCAAATCTCCTGTTGCTGCCATCA
GCATTATTACTTGGCGGTGTTCTGGCCATCGTCACGGCGTCCTTTAAAAAATACCTATAG
 Primer design