SecReT4
Protein ID: 161617518
T4SS name [ID]Tfc [713]
Gene symbol-
Locus tagSPAB_05377
StrainSalmonella enterica subsp. enterica serovar Paratyphi B str. SPB7
Repliconchromosome [GenBank: NC_010102] [Browse all T4SS(s) in this replicon]
Location [Strand]4525732..4526049 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDA9N2X0
KEGG IDspq:SPAB_05377
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 2.2e-29, Aligned region: 20..97
Protein Sequence: 105 a.a.     [Download]
>gi|161617518|ref|YP_001591484.1| hypothetical protein SPAB_05377 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
MRHTTIILAMLLPVLPVLTCQASEKDELALVMRQLDQVQAGLDRARVVANQNQDARFYFDYQQATRDIST
MRQGISTYLEPSRAQPTAPSTLVTGQYRAEEPSWR
 
Nucleotide Sequence: 318 bp     [Download]
>gi|161612313|ref|NC_010102.1|:4525732-4526049 Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7 chromosome, complete genome
ATGCGTCACACCACAATCATCCTGGCAATGTTATTGCCCGTTCTGCCGGTGCTGACCTGCCAGGCGTCAG
AAAAAGATGAGCTGGCACTCGTGATGCGCCAGCTGGATCAGGTTCAGGCTGGCCTTGATCGCGCCCGCGT
CGTAGCCAATCAGAATCAGGACGCTCGCTTTTATTTCGACTATCAGCAGGCAACCCGTGACATCTCAACG
ATGAGGCAGGGCATATCCACTTATCTCGAGCCGTCGCGCGCGCAGCCAACAGCACCCTCCACTTTAGTCA
CCGGGCAGTACCGTGCTGAGGAGCCCTCATGGCGATGA
 Primer design