SecReT4
Protein ID: 161617522
T4SS name [ID]Tfc [713]
Gene symbol-
Locus tagSPAB_05381
StrainSalmonella enterica subsp. enterica serovar Paratyphi B str. SPB7
Repliconchromosome [GenBank: NC_010102] [Browse all T4SS(s) in this replicon]
Location [Strand]4526673..4527053 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDA9N2X3
KEGG IDspq:SPAB_05381
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 2e-35, Aligned region: 3..116
Protein Sequence: 126 a.a.     [Download]
>gi|161617522|ref|YP_001591487.1| hypothetical protein SPAB_05381 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
MAVIDFLPDRLNNPPVVWKGFTSGEFVLAAVIGVIAGIPLAIPLALVPFVGWLAFPTCMLLMPLLVIFFG
GNWIASYKRGKPENYIWQRLEELRCRARMSRTMILDSRAWELKRTKPVPLMRGGKV
 
Nucleotide Sequence: 381 bp     [Download]
>gi|161612313|ref|NC_010102.1|:4526673-4527053 Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7 chromosome, complete genome
ATGGCCGTCATTGATTTCCTCCCTGACAGACTGAACAACCCCCCCGTGGTCTGGAAAGGGTTCACATCCG
GGGAGTTTGTGCTGGCGGCCGTCATCGGTGTTATTGCCGGTATCCCTCTGGCAATACCGTTAGCTCTGGT
TCCTTTTGTCGGATGGCTGGCTTTTCCGACGTGCATGCTGCTGATGCCGCTGTTGGTCATTTTTTTTGGC
GGCAACTGGATTGCCAGCTACAAGCGCGGTAAGCCAGAAAATTATATCTGGCAACGTCTGGAGGAATTGC
GCTGCCGTGCACGTATGTCCCGAACCATGATTCTGGATAGCAGGGCGTGGGAACTTAAACGAACGAAACC
TGTTCCGTTGATGCGCGGAGGGAAAGTATGA
 Primer design