SecReT4
Protein ID: 161617524
T4SS name [ID]Tfc [713]
Gene symbol-
Locus tagSPAB_05383
StrainSalmonella enterica subsp. enterica serovar Paratyphi B str. SPB7
Repliconchromosome [GenBank: NC_010102] [Browse all T4SS(s) in this replicon]
Location [Strand]4527706..4528605 [+]
Producthypothetical protein
Component typeTfc13
UniProt IDA9N2X5
KEGG IDspq:SPAB_05383
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 1.9e-110, Aligned region: 1..281
Protein Sequence: 299 a.a.     [Download]
>gi|161617524|ref|YP_001591489.1| hypothetical protein SPAB_05383 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
MKKFSVILLTLVLVSAGARAVELMKWERIPLQIPLTVGQERIVFVNKNVRVGFPPALNDKLRIQSSGGVV
YLDAKEAFPVTRLELQNKENGEILLLDVSAAPGKSTREPVKIVYDGEVATASATDKQTVSSDGDSAGRQS
SAEAKAESRRPAKLNAPLPVVLTRYAAQNMYGPLRTVEPVPGVSPVSLKLPPRITTLMPSESVSVTPMAA
WSLQGSSVIALQVRNRAAVKVILDPRSLQGQFTTATFQHRWLGRAGTPEDTTVLYLVTAGRPESAFIAEQ
RLPESEGKESKRSNRGAHK
 
Nucleotide Sequence: 900 bp     [Download]
>gi|161612313|ref|NC_010102.1|:4527706-4528605 Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7 chromosome, complete genome
TTGAAAAAATTCTCAGTGATCCTGCTGACCCTGGTACTGGTCTCAGCCGGAGCTCGTGCTGTTGAGCTTA
TGAAATGGGAACGGATACCGTTGCAGATTCCCCTGACTGTAGGGCAAGAGCGAATCGTTTTTGTAAACAA
AAACGTGCGAGTGGGGTTTCCGCCCGCACTCAACGACAAGCTGCGTATTCAAAGCTCCGGAGGTGTAGTT
TATCTCGATGCGAAAGAAGCCTTTCCGGTGACGAGACTGGAGCTTCAGAACAAGGAAAACGGGGAAATAC
TTCTACTTGATGTTTCTGCTGCCCCCGGTAAATCCACGCGGGAACCTGTCAAAATTGTCTACGACGGAGA
AGTGGCTACCGCTTCGGCGACCGATAAACAGACGGTCAGCAGTGATGGGGACAGTGCCGGCCGTCAGTCG
TCGGCAGAGGCAAAGGCAGAAAGCCGGAGACCCGCAAAACTCAATGCGCCGCTACCCGTTGTCCTGACTC
GTTATGCTGCGCAGAACATGTATGGACCGTTGCGAACGGTAGAGCCCGTACCGGGAGTAAGTCCGGTTTC
ACTGAAGCTTCCCCCCCGGATCACCACACTTATGCCCTCTGAGTCCGTCAGCGTCACGCCGATGGCTGCC
TGGAGTCTGCAGGGCAGCAGTGTAATTGCGCTGCAGGTGCGTAACCGGGCAGCAGTAAAGGTCATCCTCG
ATCCTCGTTCGCTGCAAGGTCAGTTTACTACTGCGACTTTCCAGCACCGTTGGCTGGGGCGTGCCGGTAC
ACCGGAAGACACGACAGTTCTATATCTGGTTACTGCAGGACGTCCCGAAAGTGCCTTTATTGCTGAACAG
CGTTTACCCGAATCTGAAGGAAAGGAGAGTAAGCGGAGTAACCGGGGAGCACATAAATGA
 Primer design