SecReT4
Protein ID: 161617527
T4SS name [ID]Tfc [713]
Gene symbol-
Locus tagSPAB_05386
StrainSalmonella enterica subsp. enterica serovar Paratyphi B str. SPB7
Repliconchromosome [GenBank: NC_010102] [Browse all T4SS(s) in this replicon]
Location [Strand]4530390..4530803 [+]
Producthypothetical protein
Component typeTfc15
UniProt IDA9N3S5
KEGG IDspq:SPAB_05386
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 137 a.a.     [Download]
>gi|161617527|ref|YP_001591492.1| hypothetical protein SPAB_05386 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
MLSFNHLATIMLVVVPLALSGCSTSKEEMLPPGDSTMLELWNDGASATHATNESRTTLRRPVTDSEREIN
QQVSNSYSRTQENEIQQTFPRLPNPDMVMYVFPHLAGGNTPVPGYSTVFPFYSQVQYALPGERTEDL
 
Nucleotide Sequence: 414 bp     [Download]
>gi|161612313|ref|NC_010102.1|:4530390-4530803 Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7 chromosome, complete genome
TTGCTCAGTTTTAATCATCTGGCCACCATTATGTTGGTCGTTGTACCGCTTGCCCTCTCGGGTTGCAGTA
CGTCAAAAGAGGAAATGTTGCCGCCTGGCGACAGCACCATGCTTGAATTATGGAACGATGGTGCATCGGC
AACTCATGCTACCAACGAGAGCAGAACAACACTTCGCCGGCCAGTTACAGACAGCGAACGTGAGATCAAT
CAGCAGGTCAGTAACAGCTACAGCCGCACCCAGGAAAATGAAATTCAGCAGACGTTTCCGCGTCTGCCAA
ATCCTGACATGGTCATGTATGTTTTCCCGCATCTGGCTGGCGGGAACACGCCGGTTCCAGGCTACAGCAC
CGTCTTTCCTTTCTACAGCCAGGTACAGTATGCGTTGCCTGGTGAGCGAACGGAGGATCTCTGA
 Primer design