SecReT4
Protein ID: 161617528
T4SS name [ID]Tfc [713]
Gene symbol-
Locus tagSPAB_05387
StrainSalmonella enterica subsp. enterica serovar Paratyphi B str. SPB7
Repliconchromosome [GenBank: NC_010102] [Browse all T4SS(s) in this replicon]
Location [Strand]4530803..4533619 [+]
Producthypothetical protein
Component typeTfc16
UniProt IDA9N3S6
KEGG IDspq:SPAB_05387
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 1.3e-57, Aligned region: 49..315
AAA_10 [PF12846], Evalue: 3.3e-40, Aligned region: 508..851
Protein Sequence: 938 a.a.     [Download]
>gi|161617528|ref|YP_001591493.1| hypothetical protein SPAB_05387 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
MAFPLFSRRRASQDAHQYGNGPFSVSGYEPLTREGQLTHSDEARLYSTAPSIIDHVPWGEYLPEHECILL
DDGVSVGAVYEIIPVGTEGRPETRLDEICNIAENALQDSLPELDDHQWVVQFFCQDDSDLSTYMDTIRGY
VRPRAQGTAFTKAWLAEQERHLENVAVEQGLFVDEAVTGAAWRGQIRRTRMVVYRWVETPYRDPMPPEVL
LKQVCDRLTAALSGAGIRCEKQNGEQIHSWLLRWFNPAPAWVDKKTLYRCAKHSDHAPGDLPLLNDFSES
LWFTRPRSDAESGVWWFDDVAHKAVPVARLRTAPSTGHLTGEVKRGDNVNAIMDLLPEGTVLAMTLVVQP
QDKLEESFASLSRNSMGENVDSLRAREDAATARNFLGNKHKLYRAAITLLIKAQDKETLDKRYLDLSSKL
LNCGMEPINPEHDIGPLSSYMRALPMCFNPQMDKHNWYTRLMFVQHFACLAPIYGRDTGTGHPGLTFWNR
GGGPLSVDPLNKNDRTQNAHLLLFGPTGAGKSATALDKLAQMVAIYRPRIFLLEAGNSFGLFGDYCNSLG
LSVHRVSIKPGKVISLAPFGDSHLLMQAKPETLVTSEEALPDIDEDDEDKDEERDILGEMEIAARLMITG
GEAAEEERMTRADRGMIREAILIAARKAFDENRQMLPEDLMFSLENIARDVSMGEDGREKRTPARRARAE
EMAEALRMFTEGFEGELFNRPGAQWPEADVTIVDLGTLAREGYEAQMAVAVISLLNTINNIAEREQFSDR
DIIVPIDEAHIVTANPLLGPYATKIVKMWRKLGSWLWLFTQNLEDFPDTAKKMLNMAEWWICLVMPPDEV
EQIARFKTLTEEQKAMLLSATKLPRKYTEGVILSRKVQALFRAVPPSLYLAMGMTEKEEKAERRAIMNEL
NCSELEAAFHVARRLDEKRGIGTIQGTI
 
Nucleotide Sequence: 2817 bp     [Download]
>gi|161612313|ref|NC_010102.1|:4530803-4533619 Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7 chromosome, complete genome
ATGGCTTTCCCTCTATTTAGCCGACGTCGAGCGTCTCAGGATGCTCATCAGTACGGTAACGGTCCGTTTT
CCGTCAGTGGGTATGAACCGCTTACCCGGGAAGGGCAACTGACTCATTCAGATGAAGCGCGTCTGTATTC
CACTGCACCTTCCATTATCGATCATGTTCCATGGGGCGAGTATTTGCCAGAGCATGAATGCATTCTGCTT
GACGATGGTGTTTCAGTTGGGGCCGTATATGAGATTATCCCGGTGGGCACTGAAGGGCGCCCGGAAACAC
GTCTGGACGAGATCTGCAATATCGCTGAGAACGCCCTACAGGACAGTCTCCCTGAACTGGATGATCATCA
ATGGGTGGTACAGTTTTTCTGCCAGGATGACTCTGATCTCTCTACTTATATGGATACTATCAGAGGCTAT
GTCAGGCCAAGAGCTCAGGGAACCGCATTCACTAAAGCCTGGCTGGCTGAACAGGAGCGCCACCTTGAAA
ATGTGGCGGTGGAACAGGGGCTTTTTGTAGACGAGGCTGTCACAGGGGCCGCCTGGAGAGGGCAAATTCG
CAGAACGCGCATGGTGGTTTACCGTTGGGTTGAGACACCGTATCGTGACCCCATGCCACCGGAGGTGCTG
CTGAAACAGGTCTGCGATCGCCTGACAGCAGCTCTGAGCGGTGCCGGTATCCGGTGCGAAAAGCAGAACG
GCGAGCAAATCCATAGTTGGCTGTTGCGCTGGTTCAACCCGGCGCCGGCGTGGGTCGATAAGAAAACATT
GTATCGTTGCGCAAAACACTCCGATCATGCACCGGGCGATCTGCCTCTTCTGAATGATTTCAGCGAAAGC
CTCTGGTTTACCCGCCCGCGAAGTGATGCCGAAAGCGGTGTGTGGTGGTTTGATGATGTGGCACATAAAG
CTGTTCCGGTTGCCCGCCTGCGTACTGCACCTTCCACCGGTCATCTGACGGGGGAGGTAAAACGTGGTGA
TAATGTGAATGCCATTATGGATCTGCTTCCGGAAGGGACAGTTCTGGCCATGACCCTGGTGGTTCAGCCT
CAGGACAAACTTGAAGAAAGTTTTGCGAGCCTGAGCCGCAATTCAATGGGGGAGAATGTTGATTCCCTGC
GTGCTCGTGAAGACGCTGCTACAGCGCGTAATTTCCTGGGAAACAAACACAAACTTTACCGTGCGGCCAT
CACACTGCTTATCAAGGCTCAGGACAAGGAAACACTCGATAAACGGTATCTTGATCTCAGCAGTAAGTTA
CTGAACTGTGGGATGGAACCGATAAATCCAGAACACGATATTGGCCCTCTCAGCAGTTATATGCGTGCGT
TACCCATGTGCTTTAACCCTCAAATGGATAAACACAACTGGTACACGCGCCTTATGTTTGTACAGCATTT
TGCATGTCTCGCCCCTATTTATGGTCGTGACACCGGTACTGGTCACCCGGGGCTTACGTTCTGGAATCGT
GGTGGTGGCCCCCTGTCCGTAGATCCACTTAATAAAAATGACCGTACCCAGAATGCGCACCTGCTGCTTT
TCGGGCCGACAGGTGCCGGTAAATCTGCCACTGCGCTCGATAAACTGGCTCAGATGGTGGCAATCTACCG
CCCCCGTATATTTTTGCTGGAAGCGGGTAACAGCTTCGGTCTGTTTGGAGATTACTGTAATTCGCTGGGG
CTCTCAGTGCACCGTGTCAGTATCAAGCCTGGTAAGGTTATTTCACTTGCTCCGTTTGGCGATTCACATC
TGCTCATGCAGGCGAAACCTGAGACGCTAGTGACAAGCGAAGAGGCCCTCCCTGACATTGATGAAGATGA
TGAGGACAAGGACGAAGAACGTGACATTCTGGGTGAAATGGAGATTGCAGCGCGGTTGATGATCACCGGT
GGTGAAGCAGCAGAAGAGGAGCGAATGACACGCGCCGACCGCGGTATGATTCGTGAGGCGATACTCATTG
CGGCTCGTAAAGCGTTTGACGAAAACCGCCAGATGCTACCGGAAGATTTAATGTTCTCGCTTGAGAACAT
TGCCCGCGATGTCAGCATGGGAGAAGACGGCCGCGAGAAACGCACGCCAGCGCGACGTGCACGAGCTGAA
GAGATGGCAGAAGCATTACGCATGTTTACCGAAGGTTTTGAAGGGGAGTTGTTTAACCGTCCGGGCGCGC
AATGGCCAGAGGCAGACGTGACTATTGTTGATTTAGGCACGCTGGCGCGTGAAGGCTATGAAGCTCAGAT
GGCCGTTGCTGTCATCTCGCTGCTTAATACGATTAACAATATCGCAGAAAGGGAACAGTTCAGCGATCGG
GATATCATTGTGCCAATCGACGAAGCGCATATTGTAACTGCTAACCCGCTGTTGGGCCCGTATGCAACCA
AAATTGTCAAAATGTGGCGTAAGCTCGGATCATGGCTGTGGTTGTTCACACAGAACCTGGAGGATTTCCC
TGACACTGCGAAAAAAATGCTCAATATGGCGGAGTGGTGGATCTGCCTCGTTATGCCACCTGATGAAGTT
GAACAAATAGCGCGATTTAAGACGCTCACAGAAGAGCAGAAGGCGATGCTGTTGTCCGCGACAAAACTTC
CGAGAAAATACACAGAGGGAGTTATTTTGTCCCGTAAGGTACAGGCGTTGTTTCGTGCGGTCCCCCCCAG
TTTGTACCTGGCGATGGGAATGACTGAAAAAGAGGAAAAAGCCGAAAGACGGGCCATTATGAATGAATTA
AATTGCTCGGAGCTTGAGGCCGCATTTCACGTTGCGCGCCGCCTCGATGAGAAACGTGGCATTGGTACTA
TTCAGGGGACAATATGA
 Primer design