SecReT4
Protein ID: 161617533
T4SS name [ID]Tfc [713]
Gene symbol-
Locus tagSPAB_05392
StrainSalmonella enterica subsp. enterica serovar Paratyphi B str. SPB7
Repliconchromosome [GenBank: NC_010102] [Browse all T4SS(s) in this replicon]
Location [Strand]4535677..4537071 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDA9N3T1
KEGG IDspq:SPAB_05392
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 464 a.a.     [Download]
>gi|161617533|ref|YP_001591498.1| hypothetical protein SPAB_05392 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
MKKAGLLLIFASLPAMAADISLSSSGASVSGNAISDGLFYSIGGGSVISPPPSRNNMSRIGINGGLSSDL
MCGNFDIKTTVGNQLNGITSGFKDLMGNVIQGATGAVMSMPAMAIQRANPGLYEMLTNGVLQAGLSFDKA
MLNCQSMSKKLADYTIGNKWQQVAVSEEYKDIVATSGGDAVSSDQKLQKATGEEGVTWVGGQKRGGKGQP
AIQPTRDLAKAGYNMMNNLPVTSNSSVGSSSCNGTACQRYKSSEEAAAAVVKVLGDRSIRTCRETSECTS
GGTDNQPGSAVAGTGFSPILEDATKENLEQLSKLVSGELQPTTDNLSALKTGSLVVTRGVIQALRDDPDK
AALVQRLAGELAMSDTVETALTMRRMLTTGESEPNAAEQPEAIAEGDRRIDALDRELTALRNEMELRKSI
SNNSLLTALERQGTRNQDNRLQQKAGNEDQGFSQMGQSQSSGAN
 
Nucleotide Sequence: 1395 bp     [Download]
>gi|161612313|ref|NC_010102.1|:4535677-4537071 Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7 chromosome, complete genome
ATGAAAAAAGCAGGACTTTTACTGATTTTTGCCTCGTTGCCAGCAATGGCAGCTGATATCTCTTTGTCTT
CATCGGGGGCGTCAGTGAGCGGTAACGCTATCAGCGATGGGCTCTTTTATTCTATTGGTGGCGGTTCGGT
TATTTCACCCCCGCCTAGTCGTAACAATATGTCCAGGATAGGCATTAATGGTGGCCTTAGCAGTGATCTG
ATGTGTGGCAATTTCGACATCAAAACAACCGTTGGCAACCAGCTGAATGGTATTACCAGCGGGTTTAAGG
ATCTGATGGGGAATGTGATTCAGGGGGCGACTGGTGCTGTCATGAGTATGCCGGCAATGGCTATTCAGCG
CGCAAACCCCGGGCTGTATGAAATGCTCACCAATGGCGTTCTGCAGGCCGGTTTGAGCTTTGATAAAGCG
ATGTTGAACTGTCAGAGCATGTCGAAGAAGCTGGCTGATTATACCATTGGCAATAAATGGCAGCAGGTAG
CCGTCTCTGAAGAGTACAAAGATATTGTGGCCACAAGTGGTGGCGATGCGGTTTCCAGCGACCAGAAACT
GCAAAAAGCAACTGGAGAGGAAGGCGTGACGTGGGTCGGTGGGCAGAAAAGGGGAGGTAAGGGGCAGCCC
GCAATTCAACCCACTCGGGATCTGGCCAAAGCTGGTTATAACATGATGAATAATTTGCCAGTGACCAGTA
ACAGCAGCGTCGGCTCCTCGAGCTGCAATGGTACCGCATGCCAACGTTATAAATCTTCTGAAGAGGCCGC
AGCGGCCGTTGTTAAAGTGCTTGGTGATCGCTCCATCAGGACTTGCCGGGAAACCAGTGAATGTACCAGT
GGTGGAACCGATAACCAGCCGGGCAGTGCTGTCGCTGGTACTGGCTTTTCTCCCATCCTTGAGGATGCCA
CGAAAGAGAATCTGGAGCAGCTTAGTAAGCTGGTTAGTGGTGAACTGCAGCCCACCACTGATAACCTTTC
CGCACTGAAAACCGGCAGTCTGGTTGTCACCCGCGGGGTAATTCAGGCATTACGTGACGATCCAGACAAA
GCGGCCCTGGTTCAACGGCTTGCCGGCGAACTGGCGATGTCCGACACCGTTGAAACCGCGCTAACAATGC
GCAGGATGCTCACCACCGGTGAATCCGAACCTAATGCTGCAGAGCAGCCGGAAGCTATTGCCGAGGGTGA
TCGCCGCATCGATGCCCTCGATCGCGAGCTGACGGCGCTGCGTAATGAGATGGAGTTACGCAAATCTATC
AGCAATAACAGCCTGCTGACGGCACTGGAACGGCAGGGAACAAGGAATCAGGATAACCGTCTGCAGCAGA
AAGCCGGTAACGAGGACCAGGGCTTCAGCCAGATGGGCCAGTCTCAGTCTTCCGGAGCAAACTGA
 Primer design