SecReT4
Protein ID: 161617535
T4SS name [ID]Tfc [713]
Gene symbol-
Locus tagSPAB_05394
StrainSalmonella enterica subsp. enterica serovar Paratyphi B str. SPB7
Repliconchromosome [GenBank: NC_010102] [Browse all T4SS(s) in this replicon]
Location [Strand]4537422..4538966 [+]
Producthypothetical protein
Component typeTfc19
UniProt IDA9N3T3
KEGG IDspq:SPAB_05394
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 1.6e-97, Aligned region: 8..480
Protein Sequence: 514 a.a.     [Download]
>gi|161617535|ref|YP_001591500.1| hypothetical protein SPAB_05394 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
MTANSFLEYFLVLFGWVMNNAMWSILSNTGLFALPLVVRVLGVWLKVREEGADEGNKGLLALPRIEHALY
VSYLVMLFCCIPLLPVDISTIKFDSSRAKQCGVSVPTPQNSGYKGLVNDFDGRTAEVPVWWYLLHMMSKG
TTQAMIASIPCGTNLRQMRFDVQNTKLRDPVLLQEVQEFADQCYSRAYFRLKNSNSQLSDATINSVGWIG
SSYFLNTSGYYDYYTAMTPRSQWPYNSRRDSGYPDTGAGGYPTCKTWWSDGTSGLRKRVLASFSDNTRKE
MQRQFPGQQWEEIALRWLVSPRNADLSGAGTTYAVGSSDTTSGVVGNLTRLTSSIGLGLKQAEALPGFDA
MKQALPMIQALLLMMIITVIPALMMFSAYDPKTIFTISFALFALQFITFWWELAGWLDDRLITILYDNMA
EQGIANSSVPFAAFFSSTADGWIMNLVLGMMYLVFPMFWVGMLSWAGVRIGNMANNFSDASKMPTDAGSE
AGKKAQGVAIDAASGGIKSGLSKG
 
Nucleotide Sequence: 1545 bp     [Download]
>gi|161612313|ref|NC_010102.1|:4537422-4538966 Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7 chromosome, complete genome
ATGACCGCAAACAGTTTTCTGGAATATTTTCTCGTTCTCTTTGGCTGGGTAATGAACAATGCCATGTGGA
GCATTCTCAGCAATACGGGCCTTTTTGCATTGCCACTGGTGGTCAGGGTTCTTGGCGTCTGGCTGAAAGT
GAGGGAGGAGGGGGCTGACGAGGGGAACAAAGGGCTTCTTGCCCTTCCGCGAATCGAACATGCACTGTAT
GTGTCTTATCTTGTGATGCTCTTTTGCTGCATTCCACTGTTGCCGGTGGATATCAGCACGATCAAGTTCG
ACAGTTCGCGTGCTAAACAGTGCGGCGTCAGTGTGCCGACGCCACAGAATTCTGGCTACAAGGGACTCGT
TAATGATTTTGACGGTCGTACGGCCGAGGTTCCAGTATGGTGGTATCTCCTGCATATGATGTCGAAGGGC
ACAACGCAGGCAATGATTGCGTCAATCCCATGCGGTACGAATTTGCGACAGATGCGTTTTGACGTTCAGA
ACACGAAGCTGCGTGACCCTGTGCTGCTGCAGGAGGTCCAGGAATTTGCAGATCAATGTTACTCGAGAGC
ATATTTCAGGTTGAAAAACAGCAACAGCCAGCTCAGTGATGCCACCATTAACTCTGTGGGCTGGATAGGT
AGTAGCTACTTCCTGAATACTTCCGGATATTATGACTACTACACGGCTATGACGCCACGTAGCCAGTGGC
CTTACAACAGTCGCCGGGACAGTGGCTATCCAGATACAGGCGCAGGTGGATATCCAACATGTAAGACGTG
GTGGTCCGATGGTACTTCCGGGCTTCGCAAACGAGTTCTGGCCAGCTTTAGTGATAATACACGTAAGGAG
ATGCAACGCCAGTTCCCCGGACAGCAGTGGGAAGAAATTGCGTTACGCTGGCTTGTCAGCCCACGCAACG
CAGATCTCTCCGGCGCCGGTACCACTTATGCTGTCGGCAGTAGCGACACAACCTCGGGAGTAGTCGGTAA
TCTTACACGCCTTACCTCGTCTATTGGTCTTGGACTGAAACAGGCCGAGGCGTTACCTGGTTTTGATGCA
ATGAAGCAGGCACTGCCGATGATCCAGGCATTATTGCTGATGATGATAATCACGGTCATTCCTGCATTAA
TGATGTTCAGCGCCTACGATCCGAAAACCATTTTTACTATCTCATTCGCGTTATTCGCTCTTCAGTTCAT
TACGTTCTGGTGGGAACTGGCAGGCTGGCTTGATGACAGATTGATCACCATCCTTTATGACAATATGGCT
GAGCAGGGGATTGCAAACAGCTCGGTGCCTTTCGCGGCTTTCTTTAGTTCAACGGCTGATGGATGGATTA
TGAACCTGGTACTGGGGATGATGTACCTGGTCTTTCCGATGTTCTGGGTTGGTATGCTGAGTTGGGCTGG
AGTTCGAATTGGTAATATGGCTAACAACTTTAGTGATGCTTCTAAAATGCCTACGGATGCTGGCTCGGAA
GCAGGTAAAAAAGCTCAAGGGGTGGCGATTGATGCAGCTTCAGGCGGGATTAAATCAGGATTAAGTAAAG
GATAA
 Primer design