SecReT4
Protein ID: 161620152
T4SS name [ID]VirB [372]
Gene symbol-
Locus tagBCAN_B0065
StrainBrucella canis ATCC 23365
Repliconchromosome II [GenBank: NC_010104] [Browse all T4SS(s) in this replicon]
Location [Strand]59907..60626 [-]
ProductType IV secretion system protein virB8
Component typeVirB8
UniProt IDA9MDH9
KEGG IDbcs:BCAN_B0065
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.3e-64, Aligned region: 26..234
Protein Sequence: 239 a.a.     [Download]
>gi|161620152|ref|YP_001594038.1| Type IV secretion system protein virB8 [Brucella canis ATCC 23365]
MFGRKQSPQKSVKNGQGNAPSVYDEALNWEAAHVRLVEKSERRAWKIAGAFGTITVLLGIGIAGMLPLKQ
HVPYLVRVNAQTGAPDILTSLDEKSVSYDTVMDKYWLSQYVIARETYDWYTLQKDYETVGMLSSPSEGQS
YASQFQGDKALDKQYGSNVRTSVTIVSIVPNGKGIGTVRFAKTTKRTNETGDGETTHWIATIGYQYVNPS
LMSESARLTNPLGFNVTSYRVDPEMGVVQ
 
Nucleotide Sequence: 720 bp     [Download]
>gi|161620094|ref|NC_010104.1|:c60626-59907 Brucella canis ATCC 23365 chromosome II, complete sequence
ATGTTTGGACGCAAACAATCTCCACAGAAATCAGTAAAGAACGGGCAGGGCAATGCGCCTTCGGTATATG
ACGAAGCGTTGAACTGGGAGGCCGCGCACGTCCGGCTGGTCGAAAAATCCGAACGCCGCGCGTGGAAAAT
CGCCGGGGCTTTCGGCACCATTACCGTGCTGCTCGGGATCGGCATCGCCGGGATGTTACCGCTAAAGCAA
CATGTGCCCTACCTGGTGCGCGTCAACGCACAGACAGGTGCGCCTGATATCCTGACCTCGCTCGACGAGA
AGAGTGTCAGCTACGACACTGTAATGGATAAATACTGGCTCTCGCAGTACGTGATAGCGCGTGAAACCTA
CGACTGGTACACGCTGCAAAAGGACTACGAAACCGTAGGCATGTTGTCGTCGCCGTCCGAAGGGCAGAGC
TATGCAAGCCAGTTCCAGGGCGATAAGGCGCTTGACAAGCAATATGGCTCAAATGTGCGCACATCGGTAA
CGATCGTAAGCATCGTGCCGAACGGCAAGGGCATCGGCACGGTGCGCTTTGCGAAGACGACAAAGCGCAC
CAACGAGACCGGTGACGGCGAAACAACGCACTGGATCGCCACCATTGGCTACCAATACGTCAATCCCTCT
TTGATGTCGGAATCGGCCCGCCTGACAAACCCGCTGGGTTTCAATGTCACGAGCTATCGCGTTGATCCAG
AAATGGGAGTGGTGCAATGA
 Primer design