SecReT4
Protein ID: 161620153
T4SS name [ID]VirB [372]
Gene symbol-
Locus tagBCAN_B0066
StrainBrucella canis ATCC 23365
Repliconchromosome II [GenBank: NC_010104] [Browse all T4SS(s) in this replicon]
Location [Strand]60629..60802 [-]
ProductTraI protein
Component typeVirB7
UniProt IDA9MDI0
KEGG IDbcs:BCAN_B0066
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 57 a.a.     [Download]
>gi|161620153|ref|YP_001594039.1| TraI protein [Brucella canis ATCC 23365]
MKKVILAFVATAFLAGCTTTGPAVVPVLDGKPRVPVNKSVPAKPPLAQPNPVDTYED
 
Nucleotide Sequence: 174 bp     [Download]
>gi|161620094|ref|NC_010104.1|:c60802-60629 Brucella canis ATCC 23365 chromosome II, complete sequence
ATGAAAAAGGTAATCCTTGCTTTTGTCGCCACGGCCTTCCTTGCCGGTTGCACTACAACGGGGCCGGCCG
TGGTGCCGGTTCTCGATGGCAAACCGCGGGTTCCCGTCAACAAAAGCGTTCCGGCTAAACCGCCCCTGGC
TCAGCCTAACCCCGTTGACACTTACGAGGACTAA
 Primer design