SecReT4
Protein ID: 161789224
T4SS name [ID]VirB [779]
Gene symbol-
Locus tagBMSA_0033
StrainVibrio sp. 23023 plasmid p23023 (NC_010112)
Repliconplasmid p23023 [GenBank: NC_010112] [Browse all T4SS(s) in this replicon]
Location [Strand]23187..25205 [-]
Productmobilization protein TriK
Component typeVirD4
UniProt IDA9M4Q1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 4.1e-10, Aligned region: 405..529
TrwB_AAD_bind [PF10412], Evalue: 2.4e-07, Aligned region: 405..545
T4SS-DNA_transf [PF02534], Evalue: 3e-07, Aligned region: 365..531
Protein Sequence: 672 a.a.     [Download]
>gi|161789224|ref|YP_001595620.1| mobilization protein TriK [Vibrio sp. 23023]
MLDRIEYQLYLVALNILSTLYVFTYYFGIILSFFSGLIMPILHFNKPEREEQDTVSRRLFVVLAFVLFVF
GTISNWTVPALIDLTETMYGASPQAIHYPLSQWLLIPVFIAGIVSHIYLRRTYAPILNRLKLRLTKRTEA
ARDERTDIRTLKEYLPSGINYDPEDYIDLDKGVFVGLNVDHQPQYIPLEKIRKQHAGINGTTGAGKGVIT
GLVLYQLILADEGVFALDPKDDEWAPHLLRYACEKAGKPFHLINLNKETPQLDLLAGTTPAQIEELLVAG
FSFAEKGDLADFYRIDDRKAAREAPRKASEEERQTIAGLFQSDYVQGIADTIKAFYGKMEEMSLIPAINA
PNGLNLNRVFEEGGCCYIIGSMRNSKILITQKMILIRLLQLAETRDRIHGAPRPIAIFLDELKYHISKPA
MEGLGAARDKGVHMFLAYQAVGDLRDCPADLNGDAVVGAVVENTKIKFVYRLQDPDTAEWVAKMTGKILI
DDESRYVETNSTLSEVVEGKRNIKQTERYLVDTNMWLSLPDGVGYIFTTDSIPKLSLISPIKVQKQPLEL
FTPSAQDSIDSGNTHNDSTPLLSPDVEEEEGSDSIDDAFSEYIPEPNTDEDHNVPLSQQEDEVENGHAEF
SEDIILDDPTEPVVDDEQSEPTDTKPSLNKDELEHALDKLSL
 
Nucleotide Sequence: 2019 bp     [Download]
>gi|161789205|ref|NC_010112.1|:c25205-23187 Vibrio sp. 23023 plasmid p23023, complete sequence
ATGCTCGATCGCATCGAATATCAACTCTATCTCGTAGCGTTGAATATCCTTTCAACGCTCTATGTTTTTA
CCTATTACTTTGGGATCATTCTCAGTTTTTTCTCTGGATTGATCATGCCTATTTTGCACTTCAATAAACC
CGAGAGAGAAGAGCAAGATACTGTAAGCCGACGACTGTTTGTTGTCTTAGCCTTCGTGCTTTTCGTTTTT
GGTACGATCTCAAATTGGACAGTCCCTGCATTAATTGATCTTACGGAAACCATGTATGGTGCTTCGCCAC
AAGCAATACATTATCCCCTTTCTCAATGGTTACTCATCCCCGTTTTTATTGCAGGCATCGTCAGTCATAT
TTACCTTCGCCGCACTTACGCTCCTATCCTAAATCGGCTCAAATTACGTCTAACCAAACGAACGGAAGCT
GCCCGTGATGAACGCACGGACATTCGCACCCTTAAAGAATATTTACCCAGTGGTATCAACTACGATCCCG
AAGATTACATTGATCTCGACAAAGGGGTGTTTGTCGGATTAAACGTTGATCACCAACCTCAATACATCCC
ACTAGAGAAGATCCGAAAACAACACGCTGGCATCAATGGCACCACCGGAGCGGGCAAAGGGGTGATCACC
GGACTCGTCCTCTATCAGCTGATTTTAGCTGACGAAGGTGTCTTTGCTCTCGACCCCAAAGATGACGAAT
GGGCACCACACTTATTACGTTACGCCTGCGAAAAAGCAGGCAAACCTTTTCACCTTATTAACCTCAATAA
AGAGACACCACAGCTTGATTTGTTAGCCGGCACCACACCGGCACAAATCGAAGAATTACTGGTTGCTGGA
TTCAGTTTTGCAGAGAAAGGTGACCTCGCCGATTTCTATCGAATTGATGACCGAAAAGCGGCACGAGAAG
CCCCCCGTAAAGCCTCAGAAGAAGAGCGGCAAACCATTGCTGGATTATTCCAATCAGACTACGTACAGGG
CATCGCTGACACCATCAAAGCCTTCTATGGCAAGATGGAAGAAATGTCATTAATCCCTGCTATTAACGCG
CCAAATGGCCTCAATCTAAACCGCGTCTTTGAGGAAGGAGGGTGCTGTTACATCATTGGTTCAATGCGCA
ATTCGAAGATATTAATTACCCAAAAAATGATCCTCATTCGATTACTCCAACTGGCAGAAACTCGGGATCG
AATTCATGGCGCTCCACGCCCTATTGCTATCTTTTTGGATGAGCTGAAATACCACATATCTAAACCGGCC
ATGGAAGGGTTAGGCGCAGCGCGAGATAAAGGCGTTCACATGTTTCTCGCTTACCAGGCCGTGGGAGACC
TTCGAGATTGTCCCGCAGACTTGAACGGGGACGCCGTCGTTGGGGCTGTCGTCGAAAACACAAAAATCAA
ATTTGTCTACCGATTACAAGATCCAGATACCGCAGAGTGGGTGGCAAAAATGACCGGAAAAATACTCATT
GATGATGAAAGCCGGTACGTCGAAACCAACTCTACTCTTTCCGAGGTTGTTGAGGGCAAACGTAACATCA
AACAAACCGAAAGATACTTAGTTGATACCAATATGTGGCTCAGTTTGCCTGATGGTGTAGGATATATTTT
CACTACTGATAGCATCCCGAAGTTATCTTTAATTTCACCCATCAAAGTGCAAAAGCAGCCCCTTGAACTG
TTCACACCGTCGGCACAAGACAGCATAGACAGCGGTAACACTCACAATGATTCAACGCCTCTTCTTTCAC
CTGACGTTGAAGAAGAGGAAGGTTCAGACTCTATCGATGATGCGTTTTCTGAATACATTCCAGAACCTAA
CACCGATGAAGACCACAACGTGCCGCTCTCTCAGCAAGAAGATGAGGTGGAAAATGGACACGCCGAGTTT
TCCGAAGACATCATTCTTGACGATCCTACAGAACCCGTCGTAGATGACGAGCAATCAGAGCCAACTGACA
CTAAACCATCACTCAATAAAGATGAACTAGAACACGCACTAGATAAACTGTCACTTTAA
 Primer design