SecReT4
Protein ID: 161789226
T4SS name [ID]VirB [779]
Gene symbol-
Locus tagBMSA_0044
StrainVibrio sp. 23023 plasmid p23023 (NC_010112)
Repliconplasmid p23023 [GenBank: NC_010112] [Browse all T4SS(s) in this replicon]
Location [Strand]31631..32617 [-]
Producthypothetical protein
Component typeVirB11
UniProt IDA9M4R2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.4e-63, Aligned region: 28..303
AAA_16 [PF13191], Evalue: 3.2e-08, Aligned region: 140..239
Protein Sequence: 328 a.a.     [Download]
>gi|161789226|ref|YP_001595631.1| hypothetical protein BMSA_0044 [Vibrio sp. 23023]
MNGTLPTLFGDVPEAKKGQWDLVEYYFQPLKPLFETPDVTEIFVDRFDKIRIERQGKIEQTQARFRDESD
LVSFIEQVARCLDQALDKDNPILDARLPDCSRLCCTMKEVTPQGATITLRVVPKTSITAEQLVSNDALPQ
SLLDTLQEHIRLGSNILVSGNTGSGKTTLLRVLAHSIPSEERIVTCEDTQELYLDWLPYLVSLEAPKRKN
SPVVMKTLIETALRMRPDRIWVGEIRHASAADAFLQAINTGHSGCVTTIHANNCKDAINRLQYLVSSAGL
IDFHLAQQQILGAVDLIIQTNRSPLYGRKVIEVLEIKNGQFHPVYSYS
 
Nucleotide Sequence: 987 bp     [Download]
>gi|161789205|ref|NC_010112.1|:c32617-31631 Vibrio sp. 23023 plasmid p23023, complete sequence
ATGAACGGCACCTTGCCTACTCTGTTCGGAGATGTACCAGAAGCTAAAAAAGGTCAATGGGATCTCGTCG
AGTATTACTTTCAACCCCTCAAACCTTTGTTTGAGACACCCGACGTCACCGAAATTTTTGTCGATAGGTT
CGATAAAATACGGATAGAACGGCAGGGAAAAATTGAACAAACTCAAGCTCGCTTTCGAGATGAAAGTGAT
CTGGTCAGCTTCATTGAACAAGTGGCTCGATGTTTGGATCAAGCTCTCGATAAAGACAACCCCATCCTCG
ATGCAAGGTTACCGGATTGCTCGCGCCTGTGCTGCACCATGAAAGAAGTCACCCCTCAAGGTGCTACCAT
TACACTTCGCGTCGTTCCCAAAACCTCTATCACTGCGGAGCAATTGGTCAGCAATGACGCTCTGCCTCAA
TCGCTACTCGACACGTTACAGGAGCACATTCGCCTTGGAAGCAACATTCTAGTCAGCGGAAATACGGGCT
CTGGCAAAACCACATTGCTTAGAGTCCTGGCCCACTCCATTCCATCGGAAGAACGCATTGTCACATGTGA
AGACACGCAAGAGTTGTATCTGGATTGGCTTCCGTACCTCGTTTCGCTGGAAGCTCCAAAGCGAAAAAAT
AGCCCTGTTGTTATGAAGACTTTGATTGAAACCGCACTACGGATGCGACCAGATAGAATTTGGGTGGGTG
AAATTCGTCATGCCAGTGCTGCCGATGCCTTTCTTCAAGCGATAAATACAGGCCATAGCGGATGCGTGAC
AACCATCCACGCCAATAACTGCAAAGATGCCATCAATAGACTGCAATATCTTGTCTCCAGTGCTGGCCTC
ATCGATTTTCACCTGGCACAGCAACAAATTCTGGGAGCGGTCGATCTCATTATCCAAACAAACCGAAGTC
CTCTGTATGGACGAAAAGTCATAGAGGTATTAGAGATAAAAAACGGACAGTTCCATCCTGTTTATTCCTA
TTCTTAA
 Primer design