SecReT4
Protein ID: 161789261
T4SS name [ID]VirB [779]
Gene symbol-
Locus tagBMSA_0063
StrainVibrio sp. 23023 plasmid p23023 (NC_010112)
Repliconplasmid p23023 [GenBank: NC_010112] [Browse all T4SS(s) in this replicon]
Location [Strand]51396..52124 [-]
Productconjugal transfer protein
Component typeVirB8
UniProt IDA9M4T1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.8e-07, Aligned region: 26..233
Protein Sequence: 242 a.a.     [Download]
>gi|161789261|ref|YP_001595650.1| conjugal transfer protein [Vibrio sp. 23023]
MSKSFTANDAPLTDTPPHITELGHTQAERNRYFVFCLSLIGAVLLALSFSWYAFTQAMHNKEILFIKMMP
NGTWQSVEYHAQDKQLFFKTTVDSLLARYAERRYGVIPATVAADYGEAQVFMDDNLRAQFLSPTGYNAIE
KAAKYAQNAHNDIKITWRFNDHYDRVTGNVAGVETDIMRSNIYFTRTIHIQGNPTKTTKMMLSVQWRLLP
KTELEKQDKEFLKVNPIGLIIVSETLTTEPNQ
 
Nucleotide Sequence: 729 bp     [Download]
>gi|161789205|ref|NC_010112.1|:c52124-51396 Vibrio sp. 23023 plasmid p23023, complete sequence
ATGTCGAAATCCTTTACTGCCAACGATGCGCCACTGACTGACACGCCGCCTCATATCACCGAACTCGGTC
ACACTCAGGCAGAGCGCAATCGTTACTTTGTCTTTTGTCTCTCGCTGATTGGTGCGGTGTTACTGGCTCT
GAGTTTCAGTTGGTATGCGTTTACTCAGGCCATGCACAACAAAGAGATACTGTTTATCAAAATGATGCCT
AATGGCACATGGCAAAGCGTGGAATATCATGCGCAAGATAAACAGCTTTTCTTTAAGACCACCGTGGACA
GTTTACTGGCCCGTTATGCAGAACGTCGCTATGGCGTGATACCGGCAACCGTCGCCGCCGACTATGGAGA
AGCGCAAGTCTTTATGGACGACAACTTACGAGCGCAATTCCTCTCACCGACCGGTTATAACGCGATAGAA
AAAGCCGCAAAGTATGCCCAAAATGCTCACAATGACATCAAAATAACGTGGCGTTTCAACGATCATTATG
ATCGGGTCACGGGCAATGTCGCAGGGGTAGAGACCGACATTATGCGGTCAAATATTTACTTTACTCGTAC
CATCCATATTCAAGGCAATCCCACTAAAACCACCAAAATGATGCTGTCCGTGCAATGGCGACTTCTACCC
AAAACGGAGCTAGAAAAGCAGGACAAGGAGTTTCTAAAGGTCAATCCTATTGGTCTTATTATCGTATCAG
AAACGCTCACCACCGAACCGAACCAATAG
 Primer design