SecReT4
Protein ID: 161830197
T4SS name [ID]Dot/Icm [161]
Gene symbol-
Locus tagCOXBURSA331_A1815
StrainCoxiella burnetii RSA 331
Repliconchromosome [GenBank: NC_010117] [Browse all T4SS(s) in this replicon]
Location [Strand]1657762..1658274 [-]
ProductompA family protein
Component typeIcmN
UniProt IDA9N9Q0
KEGG IDcbs:COXBURSA331_A1815
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 4.3e-14, Aligned region: 59..154
Protein Sequence: 170 a.a.     [Download]
>gi|161830197|ref|YP_001597454.1| ompA family protein [Coxiella burnetii RSA 331]
MSACSSYTTVSSAPVYTIPAPKPSLAKIRAHYIHRLQADGVQVIKLGETMRFVLLSDCLFKPDSANLRSD
YRPTLKALARLMKTYDKVNVQVAAYTDNNGHIERQQALTTRQAQVVASFLWSRGINARLAYAVGYNRKNP
VDYNGSSHGRFNNRRVEISFRFYPEYVPYA
 
Nucleotide Sequence: 513 bp     [Download]
>gi|161829703|ref|NC_010117.1|:c1658274-1657762 Coxiella burnetii RSA 331 chromosome, complete genome
TTGAGCGCTTGTTCCAGTTACACCACCGTTTCCTCGGCTCCTGTTTATACAATTCCCGCGCCAAAGCCTT
CGTTAGCAAAAATTCGCGCGCACTACATTCATCGATTACAAGCCGATGGCGTGCAAGTGATTAAATTAGG
CGAAACAATGCGTTTCGTTCTACTGAGCGATTGTTTGTTTAAACCCGATTCAGCCAATCTTCGCAGCGAT
TATCGACCGACGTTAAAGGCGTTAGCTCGATTAATGAAAACCTACGACAAAGTTAACGTTCAAGTGGCTG
CTTACACGGATAACAATGGACACATTGAGCGCCAGCAAGCGTTGACAACGCGTCAAGCACAAGTGGTGGC
GAGTTTTCTATGGTCGCGCGGCATTAATGCGCGATTAGCTTATGCCGTTGGTTACAATCGAAAAAATCCA
GTGGACTATAACGGAAGTTCTCACGGGCGATTCAATAATCGGCGCGTGGAAATAAGTTTTCGTTTTTATC
CGGAGTACGTTCCTTACGCGTAA
 Primer design