SecReT4
Protein ID: 162145962
T4SS name [ID]Trb [278]
Gene symboltraG
Locus tagGDI_0128
StrainGluconacetobacter diazotrophicus PAl 5
Repliconchromosome [GenBank: NC_010125] [Browse all T4SS(s) in this replicon]
Location [Strand]136645..138714 [+]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDA9H1X0
KEGG IDgdi:GDI_0128
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 8.4e-101, Aligned region: 137..580
TraG-D_C [PF12696], Evalue: 1.3e-30, Aligned region: 427..548
TrwB_AAD_bind [PF10412], Evalue: 3.5e-27, Aligned region: 170..562
AAA_10 [PF12846], Evalue: 8.4e-08, Aligned region: 398..501
Protein Sequence: 689 a.a.     [Download]
>gi|162145962|ref|YP_001600420.1| conjugal transfer coupling protein TraG [Gluconacetobacter diazotrophicus PAl 5]
MPDHACTLENPGSSLSRRTREGSMDQPGTRIQWGQALVVLSMIVLSWWTATQWTAWELAFQPELGRPWFT
ILHRWPVYAPPLFFWWWYEFDAYAPTVFARGAWIAGSGGVLAFAAAVALSVHRAREAKRAATYGSARWAD
DAEIRAAGLLGEDGVVLGKYRRSYLRHDGPEHALIFAPTRTGKGVGMVIPTLLTWPGSAIIHDIKGENWQ
ITAGFRSTFGRVLLFDPTNPASSAYNPLLEVRRGASEVRDVQNIADILVDPEGSLERRNHWEKTSHALLV
GAILHVLYAEADKTLAGVAKFLSDPQRSIEATLSAMMRTNHLDGKGPHPVVASAARELLNKSDNERSGVL
STAMSFLGLYRDPVVATVTSRCEWRISDLLEGEQPVSLYFVIPPSDISRTKPLIRLILNQIGRRLTEDLS
GREGRRRLLLMLDEFPALGRLDFFESALAFMAGYGIKAFLIAQSLNQIDKAYGQNNSILDNCHVRVSFAT
NDERTAKRVSDGLGVATEIRSQKNYAGHRLSPWLGHLMVSRQESARPLMTVGEVMQLPARDEVVMVAGCP
PIRARKARYFRDRRFVERVLPPPDPTQPPRTVRPDDWSGRPLPATPPPDKKSLSQSPENPDDADSEESLG
TGRKWSREHDPAETGKRKRRAAPDLFGEEPPPDPEARDRADLTRIARQAGLDRGNDLGL
 
Nucleotide Sequence: 2070 bp     [Download]
>gi|162145846|ref|NC_010125.1|:136645-138714 Gluconacetobacter diazotrophicus PAl 5 chromosome, complete genome
GTGCCGGATCATGCTTGCACCTTGGAAAATCCCGGTTCTTCGCTGTCTCGCAGGACAAGGGAGGGATCGA
TGGACCAGCCGGGAACACGTATCCAGTGGGGGCAGGCGCTGGTGGTCCTGTCCATGATCGTGCTGTCCTG
GTGGACGGCGACACAATGGACGGCCTGGGAACTGGCGTTCCAGCCGGAACTCGGCCGACCGTGGTTCACA
ATCCTGCATCGCTGGCCGGTCTACGCCCCACCACTGTTCTTCTGGTGGTGGTATGAGTTCGACGCCTACG
CGCCGACGGTTTTCGCGCGGGGGGCCTGGATCGCGGGCTCCGGCGGGGTTCTGGCTTTTGCCGCAGCCGT
GGCGCTGTCCGTCCATCGCGCCCGCGAGGCAAAGCGCGCGGCAACTTACGGCTCCGCCCGATGGGCCGAT
GATGCGGAAATCCGCGCGGCGGGGCTGCTGGGCGAGGATGGCGTTGTGCTGGGCAAATACCGCCGCAGCT
ATCTCCGGCACGATGGCCCTGAGCATGCTCTGATCTTCGCGCCGACGCGTACCGGCAAGGGGGTGGGTAT
GGTCATCCCCACGCTTCTGACCTGGCCGGGTTCGGCCATCATCCACGACATCAAGGGTGAGAACTGGCAG
ATCACCGCCGGTTTCCGGTCAACCTTTGGGCGGGTGCTGCTGTTCGACCCGACCAATCCTGCCTCGTCGG
CCTATAATCCACTGCTGGAAGTCCGACGCGGGGCGTCGGAGGTTCGTGACGTGCAGAACATCGCCGACAT
TCTGGTGGATCCCGAGGGGTCGCTGGAACGGCGCAACCACTGGGAGAAAACCTCCCATGCCCTGCTGGTC
GGGGCGATCCTGCATGTCCTTTATGCCGAAGCCGACAAGACGCTCGCCGGGGTGGCGAAGTTCCTCTCCG
ACCCGCAGCGGTCGATCGAGGCGACCCTGTCCGCCATGATGCGGACGAACCACCTGGACGGGAAGGGGCC
TCACCCCGTCGTGGCCTCCGCCGCGCGGGAATTGCTGAACAAATCTGACAACGAGCGTTCGGGCGTGCTG
TCCACCGCCATGTCGTTTCTCGGCCTCTACCGTGATCCGGTGGTGGCCACCGTGACCAGCCGCTGCGAAT
GGCGGATCAGTGATCTGCTGGAGGGTGAACAGCCTGTCTCCCTGTATTTCGTTATCCCACCTTCGGATAT
CAGCCGCACCAAGCCGCTGATCCGCCTGATCCTCAACCAGATCGGGCGGCGGCTGACCGAAGATCTGTCC
GGCCGCGAGGGGCGGCGTCGCCTACTGCTGATGCTCGACGAGTTTCCTGCCCTCGGCCGTCTGGATTTCT
TCGAGAGCGCGCTGGCCTTCATGGCGGGCTACGGGATCAAGGCGTTCCTGATCGCCCAGAGCCTGAACCA
GATCGACAAGGCGTACGGCCAGAACAACAGCATCCTGGATAATTGCCATGTCCGGGTCAGTTTCGCCACG
AACGATGAACGTACAGCAAAGCGCGTATCCGACGGTCTGGGTGTGGCCACCGAGATCCGGTCGCAGAAGA
ACTATGCCGGCCATCGGTTATCGCCCTGGCTTGGGCATCTCATGGTGTCGCGTCAGGAGAGCGCGCGGCC
CCTGATGACGGTGGGCGAAGTCATGCAGCTTCCGGCGCGGGATGAGGTGGTCATGGTGGCGGGCTGCCCG
CCGATCCGGGCGCGGAAGGCGCGGTATTTCAGGGACCGCCGCTTCGTCGAGCGTGTTCTGCCGCCGCCTG
ATCCCACGCAACCGCCGCGAACGGTCCGGCCTGATGACTGGAGCGGGCGTCCGCTTCCCGCTACTCCGCC
GCCGGACAAAAAATCACTGTCACAATCGCCAGAAAATCCTGACGACGCGGACAGTGAGGAATCCCTCGGC
ACGGGGCGGAAGTGGTCACGCGAGCATGATCCGGCGGAGACCGGAAAACGCAAGCGGCGTGCGGCACCGG
ACCTTTTTGGTGAGGAACCGCCACCGGATCCAGAAGCGCGGGATCGCGCCGACCTGACACGGATCGCTCG
GCAGGCTGGGCTCGACCGTGGCAACGATCTCGGGCTGTGA
 Primer design