SecReT4
Protein ID: 162145964
T4SS name [ID]Trb [278]
Gene symboltrbB
Locus tagGDI_0130
StrainGluconacetobacter diazotrophicus PAl 5
Repliconchromosome [GenBank: NC_010125] [Browse all T4SS(s) in this replicon]
Location [Strand]139301..140305 [+]
Producttype IV secretion system protein
Component typeTrbB
UniProt IDA9H1X4
KEGG IDgdi:GDI_0130
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.5e-87, Aligned region: 25..289
FtsK_SpoIIIE [PF01580], Evalue: 7.5e-05, Aligned region: 141..175
Protein Sequence: 334 a.a.     [Download]
>gi|162145964|ref|YP_001600422.1| type IV secretion system protein [Gluconacetobacter diazotrophicus PAl 5]
MAVTSIESGVRQRGMSMLRTAMGPAIARHLADPAIVEVMLNPDGRLWIDRLSEGLGDTGDLVTPADAERI
IRLVAHHVGAEVHESVPRVSAELPTGERFEGLLPPIVMAPSFAIRKPAVAVFTLDDYVAAGIMTEGQAAY
LRQAVADRKNILVAGGTSTGKTTLVNALLAEVAKTDDRIVLIEDTRELQCRAPNLVSLRTRDGVVTLSEL
VRSALRLRPDRIPIGEVRGPEALDLLKAWGTGHPGGIGTLHAGTAIGALHRMEQLIQEIVVTVPRALIAE
TIDVIAVLSGRGTARRLSELAEGDGLDPVTGAYRIRPVSLSSSKTSFSDNGESL
 
Nucleotide Sequence: 1005 bp     [Download]
>gi|162145846|ref|NC_010125.1|:139301-140305 Gluconacetobacter diazotrophicus PAl 5 chromosome, complete genome
ATGGCGGTCACATCGATTGAAAGTGGTGTCCGACAGCGTGGCATGTCCATGCTGCGCACGGCGATGGGAC
CGGCTATTGCCCGGCACCTCGCTGATCCTGCCATTGTCGAGGTGATGCTCAATCCCGATGGCAGGCTGTG
GATCGACCGCCTGTCCGAGGGACTGGGTGATACGGGAGATCTGGTCACACCCGCTGACGCGGAGCGTATC
ATCCGCCTGGTCGCGCATCATGTCGGGGCCGAGGTGCATGAGAGTGTGCCCCGTGTGTCGGCGGAATTGC
CGACGGGCGAGCGTTTCGAGGGATTGCTGCCGCCGATTGTGATGGCACCCAGCTTTGCGATCCGCAAGCC
TGCCGTCGCGGTGTTCACCCTCGACGATTATGTCGCTGCCGGGATCATGACGGAGGGGCAGGCGGCATAT
CTTCGCCAGGCAGTCGCGGACCGTAAAAATATTCTGGTCGCGGGAGGCACATCCACTGGCAAGACCACAT
TGGTCAACGCATTGCTGGCCGAGGTCGCGAAAACTGACGATCGCATCGTGCTGATCGAGGACACGCGCGA
ACTGCAATGCCGCGCGCCAAATCTTGTGTCGCTGCGCACCCGTGATGGTGTCGTCACGTTATCCGAACTG
GTCCGTTCAGCCCTGCGGCTGCGCCCTGACCGTATTCCCATTGGTGAGGTGCGCGGCCCCGAGGCGCTAG
ACCTGCTCAAAGCCTGGGGCACGGGTCATCCCGGTGGGATTGGCACGCTTCACGCCGGCACCGCCATCGG
TGCCCTGCATCGCATGGAGCAACTGATTCAGGAAATCGTCGTCACCGTACCGCGCGCCCTGATCGCCGAA
ACCATCGACGTGATCGCAGTCCTATCCGGACGCGGCACGGCGCGCCGCCTATCCGAACTGGCTGAAGGCG
ATGGCCTCGATCCCGTGACGGGAGCCTATCGCATCAGGCCAGTCAGCCTTTCATCTTCCAAAACATCATT
CTCTGACAATGGAGAGTCGTTATGA
 Primer design