SecReT4
Protein ID: 162145965
T4SS name [ID]Trb [278]
Gene symboltrbC
Locus tagGDI_0131
StrainGluconacetobacter diazotrophicus PAl 5
Repliconchromosome [GenBank: NC_010125] [Browse all T4SS(s) in this replicon]
Location [Strand]140302..140670 [+]
Productconjugal transfer protein trbC
Component typeTrbC
UniProt IDA9H1X7
KEGG IDgdi:GDI_0131
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.1e-22, Aligned region: 28..112
Protein Sequence: 122 a.a.     [Download]
>gi|162145965|ref|YP_001600423.1| conjugal transfer protein trbC [Gluconacetobacter diazotrophicus PAl 5]
MSPLSRLRAIVCAVARPDHRMTDLRVFGTSTLLSLVFVSSAWASGSGMPWENPLNEILESVQGPVAKIVS
VIIITVTGLTLAFGESSGGFRRLIQIVFGLSIAFAASSFFLSFFSFSGGALI
 
Nucleotide Sequence: 369 bp     [Download]
>gi|162145846|ref|NC_010125.1|:140302-140670 Gluconacetobacter diazotrophicus PAl 5 chromosome, complete genome
ATGAGTCCGCTGTCACGTCTGCGCGCCATCGTGTGCGCTGTTGCACGTCCCGATCATCGCATGACGGATC
TTCGTGTGTTCGGAACGTCCACGCTCCTGTCGCTGGTTTTCGTGTCATCGGCCTGGGCATCAGGCTCCGG
TATGCCGTGGGAAAACCCGCTCAACGAGATCCTGGAATCCGTGCAGGGGCCGGTCGCCAAGATCGTCTCG
GTGATCATCATCACCGTGACTGGCCTGACCCTCGCCTTTGGCGAGAGTTCGGGTGGGTTCCGTCGCCTGA
TCCAGATCGTCTTCGGCCTGTCCATAGCTTTTGCGGCGTCCAGCTTCTTCCTGTCGTTCTTCTCCTTCTC
CGGGGGAGCACTGATCTGA
 Primer design