SecReT4
Protein ID: 162145966
T4SS name [ID]Trb [278]
Gene symboltrbD
Locus tagGDI_0132
StrainGluconacetobacter diazotrophicus PAl 5
Repliconchromosome [GenBank: NC_010125] [Browse all T4SS(s) in this replicon]
Location [Strand]140670..140945 [+]
Productconjugal transfer protein trbD
Component typeTrbD
UniProt IDA9H1Y0
KEGG IDgdi:GDI_0132
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 2.3e-10, Aligned region: 6..86
Protein Sequence: 91 a.a.     [Download]
>gi|162145966|ref|YP_001600424.1| conjugal transfer protein trbD [Gluconacetobacter diazotrophicus PAl 5]
MAGYDDDMVPGFHVPVHRSLTDPILLGGAPRAVAIANGTLAAAIALGLRLWLIGAAFWVVGHTLAVWGAR
RDPLFIEVGRRHLRYPAWLRA
 
Nucleotide Sequence: 276 bp     [Download]
>gi|162145846|ref|NC_010125.1|:140670-140945 Gluconacetobacter diazotrophicus PAl 5 chromosome, complete genome
ATGGCGGGATATGACGATGATATGGTGCCGGGATTTCATGTCCCGGTGCATCGCTCCCTGACCGATCCAA
TCCTGCTGGGTGGGGCACCTCGCGCCGTGGCCATTGCCAACGGCACACTGGCAGCGGCTATCGCCCTCGG
CCTGCGCCTGTGGCTGATCGGCGCTGCCTTCTGGGTCGTGGGGCATACGCTGGCGGTCTGGGGTGCCAGG
CGTGATCCGCTGTTCATCGAGGTGGGGCGGCGGCATCTCCGCTATCCCGCCTGGCTGCGGGCGTAG
 Primer design