SecReT4
Protein ID: 162145967
T4SS name [ID]Trb [278]
Gene symboltrbE
Locus tagGDI_0133
StrainGluconacetobacter diazotrophicus PAl 5
Repliconchromosome [GenBank: NC_010125] [Browse all T4SS(s) in this replicon]
Location [Strand]140959..143400 [+]
Productconjugal transfer ATPase TrbE
Component typeTrbE
UniProt IDA9H1Y3
KEGG IDgdi:GDI_0133
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 4.1e-35, Aligned region: 442..717
CagE_TrbE_VirB [PF03135], Evalue: 1.1e-08, Aligned region: 182..388
Protein Sequence: 813 a.a.     [Download]
>gi|162145967|ref|YP_001600425.1| conjugal transfer ATPase TrbE [Gluconacetobacter diazotrophicus PAl 5]
MMSLGEYRNRAALLSDFLPWAALVEKGVVLNKDGSFQRTAKIRGPDLDSATPAELVGVTGRLNNALRRLG
SGWAVFVEAQRVPATIYPESDFPDAASQMVDLERREQFEDEGAHFESRYLLTLVWLPPAESSGRAERFLY
EGREREGPDPHGMLHMFVDRSDRLLALLDGFMPEASWLDDGETLTYLHSTISTRQQRVGVPEIPMHLDAL
LVDQPLSGGLEPKLGDAYLKTLTITGFPSRTFPGILDDLNRLAMPYRWSTRAILLDKSDATKVLTKIRRQ
WFAKRKSIAAIVREVMTNEASVLVDNDAANKAADADLALQSLGADDVGQAYITATITVWDGSASIAAEKL
RLVEKIIQGRDFTCMTEGLNAVEAWLGSLPGHVYANVRQPPVSTLNLAHMIPLSAVWAGPDQDVHFKAAP
LFYGKTAGATPFRFSLHVGDVGHTLIAGPTGAGKSVLLALMALQFRRYMGAQIFAFDFGGSMRATTLGMG
GDWHDLGGGLADDHPSEEQGSSVSLQPLAGIDDADERKWASEWLGQILVGEGVSLTPDVKAYLWSALNSL
ASSPSRERTLSGLVALLQSNALKQALAPYCLGGPYGRLLDAEAERLGEADVVVFETEGLIGSGAASSVLS
YLFHRIEGRLDGRPTLLMIDEGWLVLDDGDFAGQLREWLKTLRKKNASVIFATQSLSDIANSPIAPAVVE
SCPTRIFLPNERAIEPQIMAIYRDFGLNDRQIAIIARAASKREYYCQTQRGNRLFELGLGPIALALCAAS
GKDDHRLLDVVLAEHGRDGFLPAWFDARGVSWAADLLRDGGVP
 
Nucleotide Sequence: 2442 bp     [Download]
>gi|162145846|ref|NC_010125.1|:140959-143400 Gluconacetobacter diazotrophicus PAl 5 chromosome, complete genome
ATGATGTCCCTTGGAGAATATCGCAATCGTGCTGCCCTGCTGTCCGACTTCCTGCCCTGGGCAGCACTGG
TTGAGAAAGGTGTTGTCCTGAACAAGGATGGCAGTTTTCAACGCACCGCCAAAATTCGAGGCCCTGATCT
GGATAGCGCCACGCCAGCCGAACTGGTGGGTGTCACGGGGCGTCTGAACAATGCCCTGCGGCGTCTTGGT
TCCGGCTGGGCCGTGTTTGTGGAGGCACAGCGCGTGCCCGCCACGATTTATCCAGAAAGCGATTTTCCCG
ACGCGGCCAGTCAGATGGTGGATCTGGAACGCAGGGAGCAGTTCGAGGATGAGGGCGCGCATTTCGAGAG
CCGGTATTTGCTCACATTGGTCTGGCTGCCGCCAGCGGAATCTTCGGGCCGCGCCGAGCGTTTTCTCTAT
GAGGGTCGGGAGCGCGAGGGGCCGGACCCGCACGGCATGCTCCACATGTTTGTGGACCGCAGCGATCGGC
TTCTGGCCCTGCTGGACGGGTTTATGCCTGAAGCCTCCTGGCTGGATGACGGGGAGACTCTGACCTACCT
GCATTCGACCATTTCCACCCGCCAGCAGCGCGTCGGCGTGCCGGAAATTCCGATGCACCTTGATGCGCTG
CTGGTGGATCAACCGCTGTCGGGCGGTCTGGAGCCGAAACTCGGTGACGCGTATCTGAAAACCCTGACGA
TCACCGGGTTCCCCAGCCGGACCTTCCCCGGCATTCTCGATGACTTGAACCGGCTGGCGATGCCCTATCG
CTGGTCCACCCGTGCGATCCTGCTCGACAAGAGCGACGCTACCAAGGTGCTGACAAAAATCCGGCGTCAG
TGGTTTGCAAAACGCAAGAGCATTGCGGCCATTGTCCGGGAGGTCATGACCAACGAAGCATCGGTTCTGG
TGGACAATGATGCCGCCAACAAGGCGGCCGATGCCGATCTCGCGCTACAATCGCTGGGAGCGGATGATGT
GGGGCAGGCATACATCACAGCAACCATCACGGTCTGGGACGGCTCTGCTTCGATTGCTGCCGAGAAGCTG
CGTCTGGTCGAAAAAATCATCCAGGGTCGCGATTTCACCTGCATGACGGAAGGCCTCAACGCGGTGGAAG
CCTGGCTTGGGAGCCTGCCCGGTCATGTTTACGCCAATGTGCGCCAGCCTCCGGTCTCCACGTTGAACCT
TGCGCACATGATTCCGTTGTCGGCCGTCTGGGCGGGACCGGATCAGGACGTGCATTTCAAGGCCGCGCCG
CTGTTCTACGGCAAGACCGCTGGGGCCACGCCGTTCCGGTTTTCCCTGCATGTCGGCGATGTCGGTCACA
CCCTGATTGCGGGGCCAACGGGGGCGGGCAAATCCGTGTTGCTGGCGCTGATGGCCTTGCAGTTTCGCCG
GTATATGGGGGCACAGATTTTTGCCTTCGATTTCGGCGGATCCATGCGCGCGACCACACTGGGTATGGGC
GGCGACTGGCATGACCTCGGGGGTGGACTGGCGGACGATCATCCATCGGAAGAACAGGGTAGCAGCGTCT
CACTCCAGCCCCTGGCAGGGATCGACGATGCCGACGAGCGCAAATGGGCCAGCGAATGGCTGGGCCAGAT
CCTGGTCGGCGAGGGCGTATCGCTCACGCCAGACGTCAAAGCGTATCTCTGGTCAGCCCTGAACTCCCTG
GCATCATCACCCTCCCGCGAACGCACCCTGTCCGGGTTGGTGGCGCTGCTCCAGTCCAACGCGCTCAAGC
AGGCATTGGCGCCTTACTGCCTGGGTGGTCCTTATGGTCGCCTGCTCGACGCGGAGGCCGAACGTCTAGG
CGAGGCTGATGTCGTCGTGTTCGAGACCGAGGGCCTGATCGGTTCCGGCGCTGCCTCTTCCGTTCTGTCC
TACCTGTTCCACCGCATTGAAGGGAGGCTGGACGGTCGCCCAACGCTACTGATGATCGACGAGGGCTGGC
TGGTGCTGGATGATGGCGATTTCGCCGGCCAGTTGCGGGAATGGCTGAAAACCCTGCGTAAGAAGAATGC
GTCGGTGATTTTTGCTACCCAGTCGCTGTCGGATATCGCGAACTCTCCTATCGCGCCAGCCGTGGTGGAA
AGCTGTCCCACGCGGATATTCCTGCCCAACGAGCGGGCCATCGAGCCGCAGATCATGGCCATCTATCGCG
ACTTCGGTCTGAATGACCGGCAGATCGCCATCATCGCGCGGGCCGCCTCGAAGCGGGAGTATTACTGCCA
GACCCAGCGTGGCAACCGGCTGTTTGAACTCGGCCTCGGTCCTATCGCACTCGCCCTTTGCGCTGCCTCC
GGCAAGGACGATCACCGACTGCTCGATGTGGTTCTGGCGGAACATGGGCGCGACGGCTTTCTACCGGCCT
GGTTCGACGCACGCGGCGTGTCATGGGCTGCGGATCTTCTGCGCGATGGAGGCGTGCCATGA
 Primer design