SecReT4
Protein ID: 162145969
T4SS name [ID]Trb [278]
Gene symboltrbL
Locus tagGDI_0135
StrainGluconacetobacter diazotrophicus PAl 5
Repliconchromosome [GenBank: NC_010125] [Browse all T4SS(s) in this replicon]
Location [Strand]144140..145561 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDA9H1Y9
KEGG IDgdi:GDI_0135
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 4e-45, Aligned region: 41..264
Protein Sequence: 473 a.a.     [Download]
>gi|162145969|ref|YP_001600427.1| conjugal transfer protein TrbL [Gluconacetobacter diazotrophicus PAl 5]
MATNDVGVIDTFLNTFTTTIDTGFGLVKGNVISLAGTLSMLDIALAGLFWAWAADEDIIQRLVKKTLYIG
FFAWVINDFDALSKIVFDSFAALGLKVGGGTLALSDFLRPGRLASTGFDAAQPLLDSVHNLLGPVALFTN
FIQIFVLCLSWLIVLAAFFILAVQLFVALIEFKLTTLAGFVLIPFALFNRTAFLAEKVLGNVVSSGVKIM
VLAVISAIASVLFAQFSTSYGSDVPTIGQSVSVVLASLAIVGLSIFGGSIANGLISGAPQLGAGAAVGTG
MAVGAMGAAAVAGVGAAASGGAAALGATAAAARGGAAIAGAATSAYSVGAAGQTGAAGMAAAAGNVGRAA
GGAAVNAVKGKAASAASSLKDSYAAGSQWAARGMRGGKGGETGGSDGGGSPPSGGGPSGGGDAPPGGGPT
GGGDGGGGPGEPPRWARNMKRRNAAAHAAEAAHVIRSADGGGGSASIDLSEKE
 
Nucleotide Sequence: 1422 bp     [Download]
>gi|162145846|ref|NC_010125.1|:144140-145561 Gluconacetobacter diazotrophicus PAl 5 chromosome, complete genome
ATGGCCACCAACGATGTCGGGGTGATCGACACCTTCCTCAATACCTTCACCACCACCATTGATACCGGGT
TCGGTCTGGTGAAAGGGAACGTGATCTCGCTGGCCGGAACGTTATCCATGCTGGATATCGCCCTGGCCGG
GCTGTTCTGGGCGTGGGCTGCGGATGAGGACATCATCCAGCGTCTGGTGAAGAAGACGCTGTATATCGGC
TTCTTTGCCTGGGTCATCAACGATTTCGATGCGCTCTCGAAGATCGTCTTCGATAGCTTCGCGGCCCTCG
GTCTGAAAGTCGGTGGTGGAACGCTGGCGCTTTCCGATTTCCTGCGTCCTGGCCGTCTGGCTTCCACCGG
TTTTGACGCAGCCCAGCCGCTTCTGGACTCTGTCCATAATCTTCTTGGCCCTGTCGCCCTCTTTACGAAC
TTCATCCAGATCTTCGTGCTGTGCCTGTCCTGGCTGATCGTGCTGGCGGCGTTCTTCATTCTGGCCGTGC
AGCTTTTCGTGGCCCTGATCGAATTCAAGCTGACGACGCTGGCAGGATTCGTGCTGATCCCGTTCGCCCT
GTTCAATCGCACCGCCTTCCTCGCCGAGAAGGTGCTGGGCAATGTCGTCTCCTCGGGTGTGAAGATCATG
GTGCTGGCGGTCATTTCCGCCATCGCGTCGGTTCTGTTCGCCCAGTTCTCAACCTCCTACGGCAGCGACG
TTCCCACGATCGGGCAGTCCGTGTCGGTGGTGCTGGCCTCGCTTGCAATTGTCGGTCTGTCGATTTTTGG
CGGCAGCATCGCCAACGGTCTGATCTCCGGCGCTCCCCAGCTTGGAGCAGGGGCTGCGGTCGGCACTGGC
ATGGCGGTTGGTGCGATGGGCGCGGCTGCGGTTGCCGGTGTTGGAGCGGCTGCCTCGGGTGGTGCGGCTG
CACTGGGCGCGACCGCTGCTGCTGCACGCGGTGGAGCCGCGATCGCTGGGGCTGCCACGTCCGCCTATTC
CGTCGGTGCTGCCGGGCAAACTGGTGCTGCTGGTATGGCTGCTGCCGCCGGGAATGTTGGTCGCGCCGCC
GGTGGCGCGGCAGTCAACGCCGTCAAGGGCAAAGCAGCCTCCGCCGCGTCATCCCTGAAGGACAGCTATG
CCGCCGGCAGCCAATGGGCCGCGCGGGGCATGAGGGGCGGGAAGGGTGGTGAAACCGGTGGTTCTGACGG
CGGCGGATCGCCGCCATCCGGTGGTGGCCCTTCTGGAGGGGGTGATGCTCCTCCGGGCGGTGGCCCCACG
GGTGGTGGAGACGGTGGTGGTGGGCCCGGTGAGCCACCTCGCTGGGCGCGCAACATGAAGCGCCGCAATG
CCGCAGCCCATGCCGCTGAAGCCGCCCATGTCATCCGCTCCGCCGATGGCGGAGGCGGGTCGGCATCCAT
CGACCTCTCGGAGAAAGAATAA
 Primer design