SecReT4
Protein ID: 162145970
T4SS name [ID]Trb [278]
Gene symboltrbF
Locus tagGDI_0136
StrainGluconacetobacter diazotrophicus PAl 5
Repliconchromosome [GenBank: NC_010125] [Browse all T4SS(s) in this replicon]
Location [Strand]145561..146244 [+]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDA9H1Z2
KEGG IDgdi:GDI_0136
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.5e-57, Aligned region: 21..224
Protein Sequence: 227 a.a.     [Download]
>gi|162145970|ref|YP_001600428.1| conjugal transfer protein TrbF [Gluconacetobacter diazotrophicus PAl 5]
MFRRSTTRYGTMPEPVTPYQKAAQIWDERIGSARVQARNWRLIAFGSLFLSAGLGVGLVWQSARGTITPW
VVQVDRLGQAQVVASATAGYIPADPQIAWYLAQFVHDVRSLSSDAVVVRHNWLRAYDFTTPSGAVALNDY
ARLNDPFSRIGHEQVEVDIASVIRASPGSFRVAWTERHYRDGAFTGTERWTAIVSVVLRTPRDADHLRKN
PLGIYVSAINWSKELGQ
 
Nucleotide Sequence: 684 bp     [Download]
>gi|162145846|ref|NC_010125.1|:145561-146244 Gluconacetobacter diazotrophicus PAl 5 chromosome, complete genome
ATGTTCCGTCGCTCCACCACACGCTACGGGACCATGCCCGAGCCGGTGACACCCTATCAGAAAGCAGCGC
AGATCTGGGACGAGCGCATCGGCTCCGCCCGCGTACAGGCCCGAAACTGGAGGCTGATTGCCTTTGGCTC
CCTGTTCCTGTCAGCGGGGCTCGGGGTCGGGCTGGTCTGGCAATCCGCGCGCGGCACCATCACGCCGTGG
GTGGTGCAGGTGGACCGGCTGGGTCAGGCGCAGGTCGTAGCCTCCGCGACAGCGGGCTATATTCCCGCCG
ATCCGCAGATTGCCTGGTATCTGGCGCAGTTCGTCCACGACGTGCGCTCCCTGTCGTCGGACGCGGTGGT
GGTCCGGCACAACTGGCTACGCGCCTATGATTTCACCACCCCCTCCGGCGCGGTGGCGCTGAATGATTAT
GCCCGCCTGAATGATCCGTTTTCACGGATCGGGCATGAGCAGGTCGAGGTGGACATCGCCTCGGTCATCC
GGGCCTCGCCCGGCAGCTTCCGCGTGGCCTGGACCGAGCGCCATTACCGCGACGGCGCGTTCACCGGCAC
CGAGCGCTGGACCGCGATCGTCTCGGTCGTTCTGCGCACGCCGCGTGACGCCGATCACCTGCGGAAAAAT
CCCCTCGGCATCTACGTCTCCGCCATCAACTGGTCGAAGGAACTCGGACAATGA
 Primer design