SecReT4
Protein ID: 162145971
T4SS name [ID]Trb [278]
Gene symboltrbG
Locus tagGDI_0137
StrainGluconacetobacter diazotrophicus PAl 5
Repliconchromosome [GenBank: NC_010125] [Browse all T4SS(s) in this replicon]
Location [Strand]146241..147242 [+]
Producttype IV secretion system protein
Component typeTrbG
UniProt IDA9H1Z5
KEGG IDgdi:GDI_0137
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3e-63, Aligned region: 101..327
Protein Sequence: 333 a.a.     [Download]
>gi|162145971|ref|YP_001600429.1| type IV secretion system protein [Gluconacetobacter diazotrophicus PAl 5]
MIRMVMRAVPVALLALSACAGQYHLPVIRYDDAVQATRLPDPPKPVRVVEVVKPLPLPGQLKPLPLARRV
HPAPEAVDPTARITQANLAARIQPTRAGFINAVQVYPYSAGALYQVYASPGEITDIMLQQGEKLVGTGPV
AAGDTVRWIIGDTESGAGATKRIHILVKPTRPDLATNLIVNTDRRTYLAELRSTPVTYMASVSWDYPEDD
LIALHRQDSAADDAAPVDIGLNLNALNFRYAIQPVKGATPPWLPGRAFDDGHKVYIAFPTGIGQGELPPL
FVLGADGGPELVNYRVRQNWMIVDRLFAAAELRLGDKHSEQRVRIVRTDGRPS
 
Nucleotide Sequence: 1002 bp     [Download]
>gi|162145846|ref|NC_010125.1|:146241-147242 Gluconacetobacter diazotrophicus PAl 5 chromosome, complete genome
ATGATCCGCATGGTTATGCGCGCCGTTCCAGTGGCGCTGCTCGCCCTGTCCGCCTGCGCGGGGCAGTATC
ATCTGCCTGTCATTCGCTACGATGATGCCGTGCAGGCCACGCGTCTGCCGGACCCGCCGAAGCCGGTGCG
AGTGGTGGAAGTCGTGAAACCGCTTCCCCTGCCGGGGCAACTCAAGCCGCTGCCGTTAGCGCGGCGCGTC
CACCCTGCGCCTGAGGCGGTCGATCCGACAGCACGGATCACACAGGCCAATCTGGCGGCCCGCATCCAGC
CCACGCGCGCAGGCTTCATCAACGCGGTGCAGGTCTACCCCTACAGCGCAGGGGCGCTCTATCAGGTCTA
TGCCTCGCCCGGCGAGATCACCGACATCATGCTCCAGCAGGGCGAAAAGCTGGTCGGCACCGGGCCGGTG
GCCGCTGGCGATACCGTGCGCTGGATCATCGGCGATACCGAGAGCGGGGCGGGGGCGACCAAGCGCATCC
ATATTCTAGTCAAGCCGACACGGCCGGACCTGGCTACCAACCTGATCGTCAATACGGATCGGCGCACCTA
TCTCGCCGAACTGCGCTCCACGCCGGTGACGTATATGGCGTCGGTCTCGTGGGACTATCCCGAGGATGAC
CTGATTGCCCTGCATCGGCAGGACAGTGCGGCCGATGATGCTGCGCCGGTGGATATAGGGCTGAACCTGA
ATGCGCTGAATTTCCGTTACGCCATCCAGCCGGTGAAAGGCGCCACACCGCCCTGGCTACCTGGCCGGGC
CTTCGATGATGGTCACAAGGTCTATATCGCCTTCCCGACGGGGATCGGGCAGGGGGAACTGCCCCCGCTT
TTCGTGCTGGGGGCAGATGGCGGCCCGGAACTGGTCAATTACCGGGTCCGGCAGAACTGGATGATCGTCG
ATCGGCTGTTTGCCGCCGCCGAATTGCGGCTCGGGGATAAACACAGCGAACAGCGGGTGCGCATCGTCCG
CACCGACGGGCGGCCGTCATGA
 Primer design