SecReT4
Protein ID: 162145972
T4SS name [ID]Trb [278]
Gene symboltrbI
Locus tagGDI_0138
StrainGluconacetobacter diazotrophicus PAl 5
Repliconchromosome [GenBank: NC_010125] [Browse all T4SS(s) in this replicon]
Location [Strand]147239..148414 [+]
Producttype IV secretion system protein
Component typeTrbI
UniProt IDA9H1Z8
KEGG IDgdi:GDI_0138
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 5.3e-56, Aligned region: 202..380
Protein Sequence: 391 a.a.     [Download]
>gi|162145972|ref|YP_001600430.1| type IV secretion system protein [Gluconacetobacter diazotrophicus PAl 5]
MTGQAPTVGENPAPASSPPPDLRLRADRPRVVRLSRTVVWSLGGVGMVAVAFALGYALQASHRSPSTAAT
QDTDVRPSADGLAGLPADYIGNTVPKLGPALPGDLGRAILHAQGQGKAVSGTEDHRAAQEIEAAIASRLF
VQTGERDRASEQATPPAPGAPASQGRASTTTGPQAGNIAFLEGQPDRATTSPDRIAPPASPYVLQAGTVI
AGALNTKISSDLPGQIVGHVTQNVYDSPTGRYLLIPQGSLLFGAYNSGVSFGQQRTQIIWTRLIYPDGES
LVLEKLPGGDAIGQSGLSDEVDNHWGQLFKAALVTTLLSVGSEAGTSQSENNLAQAIRSGASNGFSMVGN
RLIDRSLNVQPTLTDRPGLPFTVILSRDLLLKPYQNGGNLR
 
Nucleotide Sequence: 1176 bp     [Download]
>gi|162145846|ref|NC_010125.1|:147239-148414 Gluconacetobacter diazotrophicus PAl 5 chromosome, complete genome
ATGACCGGGCAGGCACCCACAGTGGGCGAAAATCCCGCACCTGCGTCATCCCCGCCGCCCGATCTGCGTC
TGCGGGCTGATCGGCCGCGTGTCGTGCGTCTGTCGCGCACCGTGGTCTGGTCGCTGGGTGGGGTCGGCAT
GGTGGCGGTGGCCTTCGCGCTGGGTTACGCCCTTCAGGCCAGCCATCGGTCGCCATCAACGGCCGCCACG
CAGGACACCGATGTCCGTCCCTCGGCCGACGGGCTGGCGGGGCTGCCCGCCGATTATATCGGCAATACCG
TGCCGAAGCTCGGGCCAGCACTGCCCGGTGATCTCGGGCGCGCCATCCTGCATGCGCAAGGGCAGGGGAA
GGCGGTCTCCGGCACCGAAGACCACCGCGCCGCGCAGGAGATCGAGGCCGCGATCGCGAGCCGGCTGTTC
GTGCAGACGGGGGAGCGCGACCGTGCCAGCGAACAGGCGACCCCGCCCGCGCCGGGCGCTCCTGCCTCTC
AGGGGCGGGCATCCACCACGACCGGGCCACAGGCCGGAAACATTGCCTTCCTGGAAGGGCAGCCGGATCG
TGCGACAACCAGCCCCGACCGCATTGCGCCGCCTGCCTCACCTTATGTCCTCCAGGCGGGCACGGTGATC
GCTGGTGCACTGAACACGAAGATCAGTTCCGACCTGCCGGGCCAGATCGTGGGGCACGTCACGCAGAACG
TCTATGACAGCCCGACCGGGCGCTATCTTCTGATCCCCCAGGGTAGCCTGCTGTTCGGGGCTTATAACAG
CGGAGTGTCCTTCGGGCAGCAGCGCACGCAGATCATCTGGACGCGGCTTATATACCCCGACGGCGAGAGC
CTCGTGCTGGAGAAGCTGCCCGGTGGTGACGCCATCGGCCAGTCCGGCCTGTCTGACGAGGTCGACAATC
ATTGGGGCCAGCTTTTCAAAGCGGCCCTGGTGACCACGCTCCTCAGCGTCGGCTCCGAGGCGGGCACCAG
CCAGAGCGAAAACAATCTGGCCCAGGCAATCCGCTCCGGCGCCAGCAACGGCTTCTCCATGGTCGGCAAC
CGCCTGATCGACCGCAGCCTCAACGTCCAGCCCACCCTGACCGACCGGCCGGGACTACCCTTCACCGTCA
TTCTCAGCCGCGACCTATTGCTCAAACCCTATCAGAATGGAGGAAATTTAAGATGA
 Primer design