SecReT4
Protein ID: 162146830
T4SS name [ID]Trb [279]
Gene symboltrbG
Locus tagGDI_1012
StrainGluconacetobacter diazotrophicus PAl 5
Repliconchromosome [GenBank: NC_010125] [Browse all T4SS(s) in this replicon]
Location [Strand]1026749..1027735 [-]
Productconjugal transfer protein trbG
Component typeTrbG
UniProt IDA9HCJ8
KEGG IDgdi:GDI_1012
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 8.1e-68, Aligned region: 99..321
Protein Sequence: 328 a.a.     [Download]
>gi|162146830|ref|YP_001601291.1| conjugal transfer protein trbG [Gluconacetobacter diazotrophicus PAl 5]
MRTLNTIAPFMILLVPLAACSSWKPPVIRYDDTPRQAVLTPDPPKPVQVVALPEPLPLPGQLKPLPYRHG
APEPTDPHQRVERANSAARIQPTRTGYLNAIQVYPFSEGALYQLYAAPGEITDIALQPGEKLVGAGPVAA
GDTVRWIIGDTESGVGASKRIHILLKPTRPDLTTNLVINTDRRTYHLELRSDERTYMASVSWDYPQDHIV
ALRGQDRDSDLGTPVATGVDLDALNFRYRIEGDEAPWRPLRAFDDGRQVFIEFPTGIAQGEMPPLWVIGP
QGDGQLVNYRVRGNRMIVDRLFAAAELRLGAKHQQVVRIVRTDGARRS
 
Nucleotide Sequence: 987 bp     [Download]
>gi|162145846|ref|NC_010125.1|:c1027735-1026749 Gluconacetobacter diazotrophicus PAl 5 chromosome, complete genome
ATGCGCACCCTCAACACAATCGCGCCGTTCATGATCCTGTTGGTGCCGCTGGCGGCCTGCTCGTCGTGGA
AGCCGCCTGTCATCAGATACGACGATACGCCCCGGCAGGCAGTTCTTACGCCTGACCCGCCCAAGCCTGT
GCAGGTGGTGGCACTCCCCGAGCCCTTGCCGCTACCGGGGCAACTCAAGCCGCTCCCATACCGGCACGGG
GCGCCGGAACCGACGGATCCCCATCAACGGGTCGAGCGCGCCAATAGTGCGGCGCGGATCCAGCCGACGC
GGACCGGGTATCTCAATGCGATCCAGGTCTATCCGTTCTCCGAGGGTGCGCTCTATCAGCTCTACGCCGC
CCCCGGCGAGATCACCGATATCGCGCTGCAACCCGGCGAGAAGCTGGTGGGTGCCGGCCCGGTCGCCGCG
GGTGATACCGTACGCTGGATTATCGGCGACACCGAGAGCGGGGTAGGGGCGTCGAAACGGATTCATATCC
TGCTCAAACCGACGCGGCCGGACCTGACCACCAACCTGGTCATCAATACCGACCGGCGCACCTACCATCT
GGAGCTGCGCTCCGATGAGCGGACCTATATGGCCTCGGTGTCGTGGGACTATCCGCAGGACCACATCGTC
GCCCTGCGTGGGCAGGATCGGGATTCTGATCTTGGCACTCCGGTTGCGACCGGCGTCGATCTCGATGCAC
TGAATTTCCGCTACCGGATCGAGGGCGACGAGGCGCCGTGGCGGCCGTTGCGGGCCTTCGATGATGGGCG
GCAGGTGTTTATCGAGTTTCCGACCGGGATCGCCCAGGGCGAGATGCCGCCGCTCTGGGTGATCGGCCCG
CAGGGCGACGGCCAGTTGGTGAATTATCGGGTGCGCGGCAACCGGATGATCGTCGATCGTCTGTTCGCCG
CTGCCGAATTGCGGCTGGGGGCGAAGCACCAGCAGGTGGTGCGCATCGTCCGCACCGACGGGGCGCGGCG
GTCGTGA
 Primer design