SecReT4
Protein ID: 162146832
T4SS name [ID]Trb [279]
Gene symboltrbL
Locus tagGDI_1014
StrainGluconacetobacter diazotrophicus PAl 5
Repliconchromosome [GenBank: NC_010125] [Browse all T4SS(s) in this replicon]
Location [Strand]1028418..1029677 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDA9HCK4
KEGG IDgdi:GDI_1014
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 7.7e-48, Aligned region: 38..262
Protein Sequence: 419 a.a.     [Download]
>gi|162146832|ref|YP_001601293.1| conjugal transfer protein TrbL [Gluconacetobacter diazotrophicus PAl 5]
MQQGTGVIDNFLAIFTQYIDSGFGLVQGDVHWLAAALITIDITLAGLFWALAPDEDVLARLIRKTLFIGM
FAFIIGNFNGLARIIYESFAGLGIEAGGGHLTQAQLLQPGRLAQVGIDAGKPILTSISSLVGFVAIFNNA
IQIAVLLIAWLIVVISFFVMAIQLFVALIEFKLTTLAGFVLVPFGLFGRTAFLAEKVLGNVVSSGIKVLM
LAVIVGIGSTVFGQFTSGFNNPPTINDALTLILASLTLLGLTVFGPALANGLIAGGPQLGAGSAVATAAG
VIGAGVAAASGAGLAVGAAAAAVRSGAFVAGGATAAYRAGGAAGVAKTGLSAAASPLRRAAASVRTSYQA
GGAAATGGVGGATASGGGGGAGAPGKPPAWASRMQRNNRIRGGADAAAQAIKGGDRPSGGHDVDLSEGE
 
Nucleotide Sequence: 1260 bp     [Download]
>gi|162145846|ref|NC_010125.1|:c1029677-1028418 Gluconacetobacter diazotrophicus PAl 5 chromosome, complete genome
ATGCAGCAGGGCACCGGCGTCATCGACAATTTCCTCGCCATTTTCACCCAGTATATCGATTCCGGATTCG
GTCTGGTGCAGGGCGACGTGCACTGGCTCGCGGCGGCGTTGATCACGATCGACATCACCTTGGCCGGGCT
GTTCTGGGCGCTGGCGCCCGACGAGGACGTGCTGGCGCGCCTGATCCGCAAGACCCTGTTCATCGGCATG
TTTGCTTTCATCATCGGCAATTTCAACGGGCTGGCGCGGATCATCTATGAATCCTTCGCAGGCCTCGGCA
TCGAGGCGGGCGGCGGGCATCTCACCCAGGCGCAGCTTCTCCAGCCGGGGCGGCTGGCGCAGGTCGGCAT
CGACGCCGGCAAGCCGATCCTGACCTCGATCTCCTCGCTGGTTGGTTTCGTCGCCATCTTCAACAACGCG
ATCCAGATCGCCGTATTGCTGATCGCGTGGCTGATCGTGGTCATCAGCTTCTTCGTCATGGCGATCCAGC
TCTTCGTGGCGCTGATCGAGTTCAAGCTGACCACGCTGGCGGGGTTCGTGCTGGTGCCCTTCGGTCTGTT
CGGCCGCACCGCCTTCCTTGCCGAGAAGGTGCTGGGCAATGTGGTGTCGTCCGGGATCAAGGTGCTGATG
CTCGCCGTCATCGTTGGCATCGGCTCGACGGTGTTCGGCCAGTTCACCAGCGGCTTCAACAATCCGCCGA
CCATCAATGACGCGCTGACCCTGATTTTGGCTTCCCTGACGCTGCTCGGTCTGACCGTGTTCGGCCCGGC
ATTGGCCAACGGCCTGATCGCCGGTGGTCCGCAGTTGGGTGCGGGATCTGCGGTCGCTACGGCGGCCGGG
GTCATCGGTGCTGGTGTGGCCGCCGCATCAGGGGCCGGACTGGCTGTGGGAGCGGCGGCGGCGGCCGTGC
GTAGCGGCGCTTTTGTCGCGGGCGGGGCCACCGCCGCCTATCGGGCCGGCGGCGCGGCCGGTGTCGCCAA
GACTGGATTGTCTGCCGCCGCCAGTCCGTTGCGCAGGGCGGCGGCCAGTGTCCGCACCAGCTATCAGGCC
GGCGGGGCTGCCGCGACCGGCGGCGTTGGTGGTGCCACCGCTTCGGGCGGTGGCGGTGGAGCAGGGGCGC
CCGGCAAGCCGCCAGCCTGGGCCAGCCGGATGCAGCGCAACAACCGGATCAGGGGCGGGGCTGACGCCGC
CGCGCAGGCGATCAAGGGCGGCGACCGGCCCAGCGGCGGCCACGACGTCGATCTCTCGGAGGGAGAATAA
 Primer design