SecReT4
Protein ID: 162146836
T4SS name [ID]Trb [279]
Gene symboltrbC
Locus tagGDI_1018
StrainGluconacetobacter diazotrophicus PAl 5
Repliconchromosome [GenBank: NC_010125] [Browse all T4SS(s) in this replicon]
Location [Strand]1033397..1033714 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDA9HCL7
KEGG IDgdi:GDI_1018
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 7.2e-25, Aligned region: 4..95
Protein Sequence: 105 a.a.     [Download]
>gi|162146836|ref|YP_001601297.1| conjugal transfer protein TrbC [Gluconacetobacter diazotrophicus PAl 5]
MIVLRHRFAVAGATLSLALLSAPAYAAGSSMPWEEPLNQILESVQGPVAKIISVIIITVTGLTLAFGETS
GGFRRLIQIVFGLSIAFAASSFFLSFFSFSGGALI
 
Nucleotide Sequence: 318 bp     [Download]
>gi|162145846|ref|NC_010125.1|:c1033714-1033397 Gluconacetobacter diazotrophicus PAl 5 chromosome, complete genome
ATGATTGTCCTGCGCCATCGCTTTGCTGTGGCTGGCGCCACCCTCTCGCTCGCCCTGCTGTCGGCCCCGG
CCTATGCCGCCGGTTCGAGCATGCCTTGGGAGGAGCCGCTCAACCAGATCCTGGAAAGTGTGCAGGGGCC
GGTCGCCAAGATCATCTCGGTGATCATCATCACCGTGACCGGTCTGACCCTGGCCTTTGGGGAAACATCC
GGTGGCTTCCGCCGCCTGATCCAGATCGTCTTTGGTCTGTCGATCGCTTTTGCCGCGTCCAGCTTTTTCC
TGTCCTTCTTTTCCTTCTCGGGCGGGGCGCTGATCTGA
 Primer design