SecReT4
Protein ID: 162148514
T4SS name [ID]Trb [280]
Gene symboltrbI
Locus tagGDI_2736
StrainGluconacetobacter diazotrophicus PAl 5
Repliconchromosome [GenBank: NC_010125] [Browse all T4SS(s) in this replicon]
Location [Strand]2829722..2830894 [-]
Productconjugation TrbI-like protein
Component typeTrbI
UniProt IDA9HQ52
KEGG IDgdi:GDI_2736
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 2.2e-55, Aligned region: 201..378
Protein Sequence: 390 a.a.     [Download]
>gi|162148514|ref|YP_001602975.1| conjugation TrbI-like protein [Gluconacetobacter diazotrophicus PAl 5]
MTGQAPASGGSSAAPVLPPDPRLRAERPSVVRLSRTVVWSLGGMGMIAVAFALGYALQASHRAPSTPATQ
DTDVRPSADGLAGLPSDYVGKGVPKLGPALPGDLGRAILHAQGQGKAASGTEDHRAAQEVEAAIASRLFV
QTGERDRASEQATPLAQGAPATQRQASTTTGPQAGNLAFLEEQPDRATTSPDRIALPASPYILQAGTVIA
GALNTKISSDLPGQIVGHVTQNVYDSPTGRYLLIPQGSTLFGAYNSSISFGQQRIQIIWTRLIFPDGESL
VLEKLPGGDAIGQSGLSDEVDNHWGQLFKAALVTTLLSVGSEAGTSWNENNLMQAIRSGASNGFSMVGNR
LIDRSLNVQPTLTDRPGLPFTVILGPDLLLKPYRNGGNPR
 
Nucleotide Sequence: 1173 bp     [Download]
>gi|162145846|ref|NC_010125.1|:c2830894-2829722 Gluconacetobacter diazotrophicus PAl 5 chromosome, complete genome
ATGACCGGGCAGGCTCCTGCGAGCGGAGGATCTTCCGCCGCCCCGGTATTGCCGCCTGATCCGCGTCTGC
GAGCAGAACGGCCAAGTGTGGTCCGCCTCAGTCGCACCGTGGTCTGGTCGCTCGGTGGCATGGGCATGAT
CGCGGTGGCCTTCGCGCTGGGTTACGCCCTGCAGGCCAGTCATCGGGCGCCATCGACGCCCGCTACGCAG
GACACCGATGTCCGTCCCTCGGCCGACGGACTGGCGGGGCTGCCCTCCGATTATGTCGGCAAGGGCGTGC
CGAAACTCGGCCCCGCGCTGCCCGGTGATCTCGGACGCGCCATCCTGCATGCGCAAGGGCAGGGGAAGGC
GGCCTCCGGCACCGAAGATCACCGCGCCGCTCAGGAGGTCGAGGCGGCGATCGCCAGCCGACTGTTCGTG
CAGACAGGGGAGCGTGACCGCGCCAGCGAACAGGCGACGCCGCTCGCCCAGGGTGCTCCGGCCACTCAGA
GGCAGGCGTCCACCACGACCGGGCCACAGGCCGGAAACCTCGCCTTTCTGGAAGAGCAGCCTGATCGCGC
GACGACCAGCCCGGACCGCATTGCGCTGCCTGCCTCGCCCTATATCCTACAGGCCGGTACGGTGATCGCT
GGAGCGCTGAACACGAAGATCAGCTCCGACCTGCCGGGCCAGATCGTCGGTCATGTCACCCAGAACGTCT
ACGACAGCCCGACCGGCCGCTATCTGCTGATCCCGCAGGGCAGCACCCTGTTCGGAGCTTATAACAGTAG
CATCTCCTTCGGGCAGCAACGCATCCAGATCATCTGGACCCGGCTGATTTTCCCGGATGGCGAAAGTCTG
GTGTTGGAGAAGTTGCCAGGCGGCGACGCTATCGGGCAGTCGGGTCTGTCCGACGAGGTCGACAATCATT
GGGGCCAGCTCTTCAAGGCGGCCCTCGTCACGACCCTGCTCAGCGTGGGCTCAGAGGCCGGCACGTCCTG
GAACGAGAACAATCTCATGCAGGCCATCCGAAGCGGGGCGAGCAACGGCTTCTCCATGGTCGGTAACCGG
CTGATCGATCGCAGCCTGAACGTCCAGCCGACACTTACCGACCGGCCGGGACTACCGTTCACCGTCATTC
TTGGGCCCGACCTGTTGCTCAAACCCTATCGGAACGGAGGAAATCCTCGATGA
 Primer design