SecReT4
Protein ID: 162148515
T4SS name [ID]Trb [280]
Gene symbol-
Locus tagGDI_2737
StrainGluconacetobacter diazotrophicus PAl 5
Repliconchromosome [GenBank: NC_010125] [Browse all T4SS(s) in this replicon]
Location [Strand]2830891..2831892 [-]
Producttype IV secretion system
Component typeTrbG
UniProt IDA9HQ54
KEGG IDgdi:GDI_2737
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.3e-64, Aligned region: 101..327
Protein Sequence: 333 a.a.     [Download]
>gi|162148515|ref|YP_001602976.1| type IV secretion system [Gluconacetobacter diazotrophicus PAl 5]
MIRMLVRALPLTLLALSACAGQYHPPVIRYDDAVQATRLPDPPKPVQVVEVPQLLPLPGQFKPLPSRRTV
HPAPEVADPTARVTQANLAARIQPTRAGFINAVQVYPYSSGALYQVYTSPGEITDIMLQQGEKLVGTGPV
AAGDTVRWIIGDTESGAGATKRIHILVKPTRPDLTTNLIVNTDRRTYLAELRSTPATYMASVSWDYPEDD
LIALHRQDSAADEAAPVDAGLDLNALNFRYAIQPVKGGTPPWLPGRAFDDGHKVYIAFPAGIGQGELPPL
FVLRADGGPELVNYRVRQNWMIVDRLFAAAELRLGDKHSEQRVRIVRTDGRRT
 
Nucleotide Sequence: 1002 bp     [Download]
>gi|162145846|ref|NC_010125.1|:c2831892-2830891 Gluconacetobacter diazotrophicus PAl 5 chromosome, complete genome
ATGATCCGCATGCTCGTGCGCGCGTTGCCGCTGACGCTGCTCGCTCTGTCCGCCTGCGCAGGACAGTATC
ATCCGCCTGTCATTCGCTACGATGACGCCGTGCAGGCGACACGTCTGCCGGACCCGCCGAAGCCGGTACA
GGTGGTGGAGGTGCCACAGCTACTCCCGCTGCCGGGGCAGTTCAAGCCGTTGCCATCACGACGCACGGTC
CATCCGGCCCCCGAAGTCGCCGACCCGACGGCACGGGTCACGCAGGCCAATCTGGCGGCGCGCATCCAGC
CCACGCGCGCAGGCTTCATCAATGCGGTGCAGGTCTATCCCTATTCTTCCGGAGCGCTCTATCAAGTCTA
TACCTCGCCCGGCGAGATCACCGACATCATGCTCCAGCAGGGTGAAAAGTTGGTCGGCACCGGGCCGGTG
GCCGCTGGCGATACGGTGCGCTGGATCATCGGCGATACCGAAAGCGGGGCCGGGGCGACAAAGCGCATCC
ATATTCTGGTCAAGCCGACGCGACCGGACCTCACCACCAACCTGATCGTCAATACGGACCGGCGGACCTA
TCTCGCCGAACTGAGGTCGACACCGGCAACCTATATGGCATCGGTGTCGTGGGATTACCCCGAGGATGAC
CTGATCGCCCTGCACCGGCAGGACAGTGCGGCCGACGAAGCGGCACCGGTGGATGCAGGGCTGGATCTGA
ACGCCCTGAATTTCCGTTACGCCATCCAGCCGGTGAAAGGCGGGACGCCACCCTGGCTTCCCGGCCGGGC
GTTTGACGATGGCCACAAGGTCTATATCGCGTTTCCTGCCGGGATCGGACAGGGCGAATTGCCGCCGCTC
TTTGTGCTTAGGGCGGATGGCGGGCCGGAACTGGTGAATTACCGGGTCCGGCAGAACTGGATGATCGTCG
ATCGCCTGTTTGCCGCCGCCGAACTGCGGCTGGGCGACAAACATTCCGAACAGCGGGTGCGGATTGTCCG
CACCGACGGGCGGCGGACATGA
 Primer design