SecReT4
Protein ID: 162148516
T4SS name [ID]Trb [280]
Gene symboltrbF
Locus tagGDI_2738
StrainGluconacetobacter diazotrophicus PAl 5
Repliconchromosome [GenBank: NC_010125] [Browse all T4SS(s) in this replicon]
Location [Strand]2831889..2832575 [-]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDA9HQ57
KEGG IDgdi:GDI_2738
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.2e-56, Aligned region: 22..225
Protein Sequence: 228 a.a.     [Download]
>gi|162148516|ref|YP_001602977.1| conjugal transfer protein TrbF [Gluconacetobacter diazotrophicus PAl 5]
MMFRRSTTRYGTTPEPVTPYQKAVQVWDERIGSARIQARNWRLMAFGSLFLSAGLGAGLVWQSMRGTITP
WVVQVDRLGPAQVVAPATGGYMPADPQIAWYLAQFVHDVRSLSSDAVVVRHNWLRAYDFTTTSGAAALND
YARLNDPFSRIGHEQVEVDIASVIRASPGSFRVAWTERHYRDGAFTGTERWTAIVSVVLRTPRDADHLRR
NPLGIFVSAINWSKELGQ
 
Nucleotide Sequence: 687 bp     [Download]
>gi|162145846|ref|NC_010125.1|:c2832575-2831889 Gluconacetobacter diazotrophicus PAl 5 chromosome, complete genome
ATGATGTTCCGTCGCTCCACCACACGCTATGGGACCACGCCCGAGCCGGTGACACCCTATCAGAAAGCAG
TGCAGGTGTGGGACGAGCGCATTGGTTCCGCCCGCATCCAGGCCCGTAACTGGCGGCTGATGGCGTTCGG
TTCCCTGTTCCTGTCCGCCGGTCTCGGGGCTGGCCTGGTCTGGCAGTCTATGCGCGGCACCATCACGCCG
TGGGTGGTGCAGGTGGACCGGCTGGGGCCGGCGCAGGTCGTAGCCCCGGCGACAGGGGGCTACATGCCCG
CCGATCCGCAGATCGCCTGGTATCTGGCGCAGTTCGTTCACGACGTCCGTTCCTTGTCGTCGGACGCCGT
GGTGGTCCGGCACAACTGGCTGCGCGCCTATGATTTCACCACCACGTCCGGGGCTGCGGCCCTGAACGAT
TACGCGCGGCTCAATGATCCGTTCTCGCGCATCGGGCACGAACAGGTCGAGGTGGACATCGCCTCGGTCA
TCCGCGCCTCGCCCGGCAGCTTCCGCGTTGCCTGGACTGAGCGCCATTACCGCGACGGGGCGTTTACTGG
CACCGAGCGCTGGACCGCCATCGTCTCGGTCGTTCTGCGCACGCCCCGCGATGCCGATCATCTTCGCCGC
AATCCACTCGGGATTTTCGTCTCCGCCATCAACTGGTCGAAGGAGTTGGGTCAATGA
 Primer design