SecReT4
Protein ID: 162148518
T4SS name [ID]Trb [280]
Gene symboltrbJ
Locus tagGDI_2741
StrainGluconacetobacter diazotrophicus PAl 5
Repliconchromosome [GenBank: NC_010125] [Browse all T4SS(s) in this replicon]
Location [Strand]2834026..2834760 [-]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDA9HQ61
KEGG IDgdi:GDI_2741
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 244 a.a.     [Download]
>gi|162148518|ref|YP_001602979.1| conjugal transfer protein TrbJ [Gluconacetobacter diazotrophicus PAl 5]
MGLFASVTALAVGAGVSSVQSAHAQWAVYDGAAHVQTVLIAARELQQIDNQITSLANQAQMLVNQARNLA
LLPFSTLSTLRSTIFQTTALLAQAQNIAYSVQSVEQQYQQSYTSVSSGMSDSALFSQAQTRWQNSVGGFE
DALKMQARAVGNIPSDSSAMTQLVSASQSSSGALQAAQAGNQLLALQSRQLSDVVAVLSANGRAQDLDRA
REAAGEAEGLAQYEHFAQHDAYVPGAVSVFNDGN
 
Nucleotide Sequence: 735 bp     [Download]
>gi|162145846|ref|NC_010125.1|:c2834760-2834026 Gluconacetobacter diazotrophicus PAl 5 chromosome, complete genome
ATGGGACTGTTCGCATCCGTCACGGCGCTGGCCGTTGGTGCCGGCGTCAGTTCGGTGCAATCCGCCCATG
CGCAATGGGCGGTCTATGACGGTGCTGCGCATGTCCAGACCGTGCTGATCGCGGCGCGGGAATTGCAGCA
GATCGACAACCAGATCACGTCTCTCGCCAATCAGGCGCAGATGTTGGTTAACCAGGCGAGGAATCTCGCC
CTGTTGCCATTTTCGACATTGTCGACGCTGCGATCAACGATTTTCCAGACCACCGCGCTACTCGCGCAGG
CGCAGAACATCGCCTACAGCGTCCAGTCTGTCGAACAGCAGTACCAGCAGTCCTACACGTCCGTCTCTTC
GGGGATGTCCGACAGTGCCCTGTTCAGCCAGGCCCAGACCCGCTGGCAGAATTCCGTCGGCGGGTTCGAG
GATGCCCTGAAGATGCAGGCCCGTGCCGTCGGCAATATCCCGTCCGATAGCAGCGCCATGACCCAGCTCG
TCTCAGCAAGCCAGAGTTCGAGCGGCGCGCTCCAGGCGGCGCAGGCCGGCAACCAGCTTCTGGCCCTGCA
ATCCCGGCAGCTCTCGGACGTGGTTGCCGTGCTGTCGGCCAACGGACGGGCACAGGACCTCGACCGGGCG
CGTGAGGCGGCGGGCGAGGCGGAAGGCCTGGCGCAATATGAACATTTTGCGCAGCACGACGCCTACGTGC
CGGGCGCCGTCTCTGTCTTCAATGACGGGAACTGA
 Primer design