SecReT4
Protein ID: 162148519
T4SS name [ID]Trb [280]
Gene symboltrbE
Locus tagGDI_2742
StrainGluconacetobacter diazotrophicus PAl 5
Repliconchromosome [GenBank: NC_010125] [Browse all T4SS(s) in this replicon]
Location [Strand]2834802..2837234 [-]
Productconjugal transfer ATPase TrbE
Component typeTrbE
UniProt IDA9HQ64
KEGG IDgdi:GDI_2742
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.6e-36, Aligned region: 442..718
CagE_TrbE_VirB [PF03135], Evalue: 1.9e-09, Aligned region: 182..388
Protein Sequence: 810 a.a.     [Download]
>gi|162148519|ref|YP_001602980.1| conjugal transfer ATPase TrbE [Gluconacetobacter diazotrophicus PAl 5]
MMSLGEYRNRAALLSDYLPWAALVEKSVVLNKDGSFQRTAKIRGPDLDSATPAELVGVTGRLNNALRRLG
SGWAVFVEAQRVPATLYPESDFPDAASHMVDLERREAFEDEGAHFESRYFLTLVWLPPAESSGRAERFLY
EGREREGPDPHGMLHAFVDRTDRMLALLEGFMPEAAWLDDGETLTYLHSTISTRQQRVRVPEIPMHLDAL
LVDQPLSGGLEPKLGDAYLKTLTITGFPSRTFPGILDDLNRLAMPYRWSTRAILLDKTDATKVLTRIRRQ
WFAKRKSIAAIVREVMTNEASALVDNDAANKAADADLALQSLGADDVGQAYITATVTVWDGSAAIAAEKL
RLVEKIIQGRDFTCMAESLNAVEAWLGSLPGHVYANVRQPPVSTLNLAHMIPLSAVWAGPEQDGHFKAPP
LFYGKTAGATPFRFSLHVGDVGHTLIAGPTGAGKSVLLALMALQFRRYVGSQIFVFDFGGSMRAATLAMG
GDWHDLGGGLTDEGDGDLAVALQPLAWIDDPDERKWATEWLGQILVGEGLTLTPEVKSHLWSALNSLASS
PVHERTLSGLVALLQSNALKQALAPYCLGGPYGHLLDADTERLGDANVVVFETEGLIGSGAASSVLSYLF
HRIEGRLDGRPTLLVIDEGWLVLDDGDFAGQLREWLKTLRKKNASVIFATQSLSDIANNAIAPAVVESCP
TRIFLPNERAIEPQIATIYRDFGLNDRQIAIIARAASKREYYCQTQRGNRLFELGLGPVALALCAASGKD
DHKLIDAVLAEHGRAGFLAAWFDARSVAWAADLLREGDVP
 
Nucleotide Sequence: 2433 bp     [Download]
>gi|162145846|ref|NC_010125.1|:c2837234-2834802 Gluconacetobacter diazotrophicus PAl 5 chromosome, complete genome
ATGATGTCCCTTGGGGAATATCGCAATCGTGCTGCTCTGCTGTCGGACTACCTGCCCTGGGCCGCGCTGG
TTGAGAAAAGCGTGGTCCTGAACAAGGATGGTTCCTTCCAGCGTACGGCGAAAATTCGCGGTCCAGATCT
GGATAGCGCCACACCAGCGGAACTGGTTGGTGTCACCGGACGGTTGAACAATGCGCTCCGTCGTCTTGGC
TCCGGCTGGGCGGTGTTCGTCGAGGCGCAGCGCGTCCCGGCGACGCTTTATCCCGAGAGCGATTTCCCCG
ATGCTGCCTCGCACATGGTCGATCTGGAACGGCGCGAGGCGTTCGAGGATGAGGGCGCGCATTTCGAGAG
CCGGTATTTTCTGACCCTGGTCTGGCTGCCGCCAGCGGAATCATCGGGCCGTGCCGAACGCTTTCTCTAT
GAGGGCAGGGAGCGCGAGGGGCCTGATCCGCATGGAATGCTTCATGCGTTCGTGGATCGCACGGACCGGA
TGCTGGCGTTGCTGGAGGGCTTCATGCCCGAAGCGGCGTGGCTCGATGACGGCGAGACGCTGACATACCT
GCATTCGACGATCTCGACCCGGCAGCAGCGTGTCCGTGTACCGGAAATCCCGATGCACCTCGATGCCCTG
CTGGTGGACCAGCCGCTTTCGGGCGGTCTGGAACCGAAACTCGGCGATGCGTATCTGAAAACCCTGACGA
TCACCGGTTTCCCGTCGCGGACCTTCCCCGGAATCCTGGATGACCTGAACCGGCTGGCCATGCCCTATCG
CTGGTCCACCCGCGCCATCCTGCTCGACAAGACGGATGCGACGAAGGTGCTGACCCGCATTCGTCGCCAG
TGGTTCGCCAAACGGAAATCGATCGCAGCGATCGTGCGTGAGGTGATGACCAACGAGGCGTCGGCCCTGG
TTGATAACGATGCCGCCAACAAGGCGGCCGACGCTGATCTGGCCCTGCAATCGCTGGGGGCGGATGATGT
CGGGCAGGCCTACATCACCGCGACCGTCACGGTTTGGGATGGTTCCGCTGCCATCGCTGCGGAAAAGCTC
CGCCTGGTCGAGAAGATCATTCAGGGCCGCGACTTCACCTGCATGGCCGAAAGCCTGAATGCCGTTGAGG
CGTGGCTGGGATCTCTGCCCGGTCATGTCTATGCCAATGTTCGTCAACCGCCGGTCTCGACCTTGAATCT
GGCCCACATGATCCCGCTGTCGGCGGTCTGGGCTGGGCCGGAGCAGGACGGGCATTTCAAGGCGCCGCCG
CTGTTCTATGGGAAAACAGCCGGGGCGACGCCATTCCGGTTTTCCCTGCATGTCGGGGATGTCGGTCACA
CCCTGATCGCCGGCCCGACAGGGGCGGGCAAATCTGTGCTGCTGGCTCTGATGGCGCTCCAGTTTCGTCG
CTACGTGGGATCGCAGATTTTCGTATTTGATTTCGGCGGCTCTATGCGGGCCGCAACACTCGCGATGGGT
GGGGACTGGCATGATCTGGGTGGCGGGCTGACAGATGAGGGAGATGGTGATCTCGCCGTCGCCCTCCAGC
CGCTGGCGTGGATTGACGATCCCGACGAGCGCAAATGGGCCACGGAATGGCTGGGGCAGATTCTTGTCGG
CGAAGGGTTAACACTTACCCCCGAGGTGAAGTCCCACCTCTGGTCGGCCCTCAATTCCCTGGCGTCCTCG
CCCGTGCATGAGCGGACCCTGTCAGGGTTAGTCGCCCTGCTCCAGTCCAACGCTCTGAAGCAGGCTTTGG
CACCGTACTGCCTCGGCGGTCCCTATGGCCACCTGCTCGATGCCGATACCGAGCGTCTGGGCGATGCCAA
TGTGGTGGTGTTCGAGACCGAAGGGCTGATCGGCTCCGGCGCGGCGTCTTCCGTGCTGTCCTATCTGTTT
CACCGCATCGAGGGCCGTCTGGACGGGCGGCCCACCCTGCTGGTCATCGACGAGGGCTGGCTGGTGCTGG
ATGACGGCGATTTCGCGGGGCAACTCCGGGAGTGGCTGAAAACCCTGCGCAAGAAGAATGCGTCGGTGAT
TTTCGCCACCCAGTCCCTGTCCGACATCGCGAACAACGCGATTGCGCCGGCCGTGGTGGAAAGTTGCCCG
ACGCGGATCTTCCTGCCGAACGAGCGGGCCATCGAGCCGCAGATAGCCACGATTTATCGGGATTTCGGGC
TGAATGACCGGCAGATCGCCATCATTGCCCGTGCCGCGTCGAAGCGGGAGTATTATTGCCAGACCCAGCG
CGGCAACCGTCTGTTCGAGCTGGGGCTGGGACCGGTGGCGCTCGCCCTGTGCGCGGCATCCGGGAAGGAC
GATCACAAGCTGATTGATGCGGTGCTGGCGGAACACGGACGTGCCGGATTTCTCGCGGCATGGTTCGACG
CACGCAGCGTGGCATGGGCTGCGGACCTTCTGCGGGAAGGAGACGTGCCATGA
 Primer design