SecReT4
Protein ID: 162148520
T4SS name [ID]Trb [280]
Gene symboltrbD
Locus tagGDI_2743
StrainGluconacetobacter diazotrophicus PAl 5
Repliconchromosome [GenBank: NC_010125] [Browse all T4SS(s) in this replicon]
Location [Strand]2837247..2837525 [-]
Productconjugal transfer protein trbD
Component typeTrbD
UniProt IDA9HQ67
KEGG IDgdi:GDI_2743
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 2e-10, Aligned region: 15..86
Protein Sequence: 92 a.a.     [Download]
>gi|162148520|ref|YP_001602981.1| conjugal transfer protein trbD [Gluconacetobacter diazotrophicus PAl 5]
MAVGYDDDAVPGFHVPVHRSLTDPILLGGAPRAVAIANGTLAAAIALGLRLWLIGAAFWIVGHTLAVWGA
KRDPLFIEVGRRHLRYPAWLRT
 
Nucleotide Sequence: 279 bp     [Download]
>gi|162145846|ref|NC_010125.1|:c2837525-2837247 Gluconacetobacter diazotrophicus PAl 5 chromosome, complete genome
ATGGCCGTCGGATATGACGATGACGCGGTACCGGGTTTCCATGTTCCGGTGCATCGGTCGCTGACTGACC
CGATCCTGCTGGGTGGGGCACCCCGAGCCGTGGCGATCGCCAATGGCACGCTGGCGGCGGCCATAGCGCT
CGGCCTGCGTCTCTGGCTGATCGGGGCCGCGTTCTGGATCGTGGGCCATACTCTGGCGGTCTGGGGTGCG
AAGCGCGATCCGCTGTTCATCGAGGTGGGACGGCGGCATCTGCGCTACCCCGCCTGGCTCCGGACTTAA
 Primer design