SecReT4
Protein ID: 162148521
T4SS name [ID]Trb [280]
Gene symboltrbC
Locus tagGDI_2744
StrainGluconacetobacter diazotrophicus PAl 5
Repliconchromosome [GenBank: NC_010125] [Browse all T4SS(s) in this replicon]
Location [Strand]2837525..2837857 [-]
Productconjugal transfer protein trbC
Component typeTrbC
UniProt IDA9HQ69
KEGG IDgdi:GDI_2744
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 4.7e-23, Aligned region: 6..100
Protein Sequence: 110 a.a.     [Download]
>gi|162148521|ref|YP_001602982.1| conjugal transfer protein trbC [Gluconacetobacter diazotrophicus PAl 5]
MTRALFRVRQHAPVIAAMLLLSVAWCSSALASGSDMPWETPLNEILQSVQGPVAKIISVIIITITGLTLA
FGESSGGFRRLIQIVFGLSIAFAASSFFLSFFSFSGGALI
 
Nucleotide Sequence: 333 bp     [Download]
>gi|162145846|ref|NC_010125.1|:c2837857-2837525 Gluconacetobacter diazotrophicus PAl 5 chromosome, complete genome
ATGACCCGCGCTCTCTTTCGCGTGCGCCAGCACGCGCCTGTCATTGCCGCCATGCTGCTGCTTTCGGTTG
CATGGTGCTCCTCGGCCCTGGCGTCCGGGTCGGACATGCCATGGGAAACGCCTCTGAACGAGATCCTGCA
ATCCGTGCAGGGTCCGGTGGCCAAGATCATCTCGGTGATCATCATCACAATCACGGGTCTGACCTTGGCC
TTCGGCGAGTCCTCAGGCGGATTCCGTCGCCTGATCCAAATCGTCTTCGGTCTGTCCATCGCTTTTGCCG
CCAGCTCGTTCTTCCTGTCGTTCTTCTCCTTCTCTGGCGGAGCGCTGATCTGA
 Primer design