SecReT4
Protein ID: 162148522
T4SS name [ID]Trb [280]
Gene symbol-
Locus tagGDI_2745
StrainGluconacetobacter diazotrophicus PAl 5
Repliconchromosome [GenBank: NC_010125] [Browse all T4SS(s) in this replicon]
Location [Strand]2837854..2838783 [-]
Producttype II/IV secretion system protein
Component typeTrbB
UniProt IDA9HQ71
KEGG IDgdi:GDI_2745
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 5.7e-86, Aligned region: 11..273
TrwB_AAD_bind [PF10412], Evalue: 1.2e-05, Aligned region: 130..166
FtsK_SpoIIIE [PF01580], Evalue: 4.2e-05, Aligned region: 130..159
Protein Sequence: 309 a.a.     [Download]
>gi|162148522|ref|YP_001602983.1| type II/IV secretion system protein [Gluconacetobacter diazotrophicus PAl 5]
MLRTAMGPAIAGHLADSAVVEVMLNPDGRLWIDRLADGMADTGETITPADAERIVRLVAHHVGAEVHEAA
PRVSAELPTGERFEGLLPPVVTAPSFAIRKPAVAVFTLDDYVETGIMTAKQAAYLRNAVAERKNILVAGG
TSTGKTTLVNALLAEVAKTGDRVVLIEDTRELQCTAPNLIALRTREGVITLSDLVRSGLRLRPDRIPIGE
VRGAEALDLVKAWGTGHPGGIGTLHAGSVLAALYRLEQLIQEAVVTVPRAMIAETIDVIAVLSGRGNARR
LSELATVDGIDPAIGIYRIHPVHANGDSR
 
Nucleotide Sequence: 930 bp     [Download]
>gi|162145846|ref|NC_010125.1|:c2838783-2837854 Gluconacetobacter diazotrophicus PAl 5 chromosome, complete genome
ATGCTGCGCACGGCGATGGGACCGGCGATTGCGGGGCATCTTGCCGATTCCGCTGTGGTCGAGGTGATGC
TCAATCCCGACGGGCGGCTGTGGATCGACCGTCTGGCGGACGGCATGGCGGACACGGGTGAAACCATCAC
ACCGGCCGATGCCGAGCGCATCGTGCGCCTGGTCGCCCATCATGTCGGGGCGGAGGTGCATGAGGCCGCA
CCACGCGTCTCGGCGGAACTGCCAACCGGTGAGCGCTTCGAGGGGCTGTTGCCGCCTGTGGTGACGGCCC
CGAGCTTCGCGATCCGCAAGCCCGCCGTCGCCGTGTTCACCCTCGACGACTATGTCGAGACCGGGATCAT
GACCGCAAAGCAGGCGGCATATCTTCGCAACGCTGTCGCAGAGCGAAAGAATATCCTGGTCGCGGGCGGC
ACGTCGACCGGCAAGACCACATTGGTCAATGCCCTGCTGGCCGAGGTGGCCAAAACCGGTGATCGCGTCG
TCCTGATCGAGGATACGCGCGAACTGCAATGCACGGCGCCTAATCTCATAGCCCTGCGGACCCGTGAAGG
CGTGATTACCCTTTCGGATCTCGTCCGGTCCGGTCTCCGCCTACGCCCCGACCGTATTCCGATCGGTGAG
GTGCGTGGTGCCGAAGCACTCGATCTGGTCAAGGCATGGGGCACTGGCCATCCGGGCGGCATCGGTACGC
TGCATGCCGGATCGGTGCTGGCTGCCCTGTATCGTCTGGAACAACTGATCCAGGAAGCCGTGGTCACGGT
GCCGCGCGCCATGATCGCGGAAACCATTGACGTGATCGCGGTCCTGTCCGGACGCGGCAATGCCCGCCGG
CTGTCCGAACTCGCCACCGTGGACGGGATTGATCCCGCCATAGGTATCTATCGCATTCATCCAGTACATG
CCAACGGAGATTCTCGATGA
 Primer design