SecReT4
Protein ID: 162148526
T4SS name [ID]Trb [280]
Gene symboltraG
Locus tagGDI_2749
StrainGluconacetobacter diazotrophicus PAl 5
Repliconchromosome [GenBank: NC_010125] [Browse all T4SS(s) in this replicon]
Location [Strand]2841640..2843640 [-]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDA9HQ82
KEGG IDgdi:GDI_2749
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 5.7e-101, Aligned region: 114..557
TraG-D_C [PF12696], Evalue: 3.4e-30, Aligned region: 404..525
TrwB_AAD_bind [PF10412], Evalue: 2.9e-26, Aligned region: 149..539
AAA_10 [PF12846], Evalue: 3.4e-07, Aligned region: 375..478
Protein Sequence: 666 a.a.     [Download]
>gi|162148526|ref|YP_001602987.1| conjugal transfer coupling protein TraG [Gluconacetobacter diazotrophicus PAl 5]
MDQPGTRIQWGQALVVLSMIVLSWWTATQWTAWELAFQPELGRPWFTVLHRWPVYAPPLFFWWWYELDAY
APAVFARGAWIAGSGGVLAFAAAVALSVHRAREAKRAATYCSARWAEDAEIRAAGLLGEDGVVLGRYRRA
YLRHDGPEHVLTFAPTRTGKGVGMVIPTLLTWPGSAIIHDIKGENWQITAGFRNRFGRVLLFDPTNPASS
AYNPLLEVRRGASEVRDVQNIADILVDPEGSLERRNHWEKTSHALLVGAILHVLYAEDDKTLAGVAKFLS
DPKRSIEATLSAMMRTNHLDGKGPHPVVASAARELLNKSDNERSGVLSTAMSFLGLYRDPVVATVTSRCE
WRIGDLLEGDQPVSLYFVIPPSDISRTKPLIRLILNQIGRRLTEDLSGREGRRRLLLMLDEFPALGRLDF
FESALAFMAGYGIKAFLIAQSLNQIDKAYGQNNSILDNCHVRVSFATNDERTAKRVSDGLGVATEIRSQK
NYAGHRLSPWLGHLMVSRQESARPLMTVGEVMQIPAREEVVMVAGCPPIRARKARYFRDRRFVERVLPPP
DPAQLPRPVRPDDWSGRPSPVTPPPEQTGAPAAPDKPDDADSDESLGTGRKWSREHDPADIGKHRKRTVP
DLFGEEPPPDPEARDRADLTRIARQAGLDRGNDLGL
 
Nucleotide Sequence: 2001 bp     [Download]
>gi|162145846|ref|NC_010125.1|:c2843640-2841640 Gluconacetobacter diazotrophicus PAl 5 chromosome, complete genome
ATGGACCAGCCGGGAACACGTATCCAGTGGGGGCAGGCGCTCGTGGTCCTGTCCATGATCGTGCTGTCCT
GGTGGACGGCGACACAATGGACGGCCTGGGAACTGGCGTTCCAGCCGGAACTCGGCCGACCGTGGTTCAC
GGTCCTGCATCGCTGGCCGGTCTATGCCCCGCCACTGTTCTTCTGGTGGTGGTACGAGCTCGACGCCTAC
GCCCCGGCGGTCTTCGCGCGCGGCGCGTGGATTGCGGGCTCGGGCGGTGTGCTGGCCTTTGCCGCAGCCG
TGGCGCTGTCCGTCCATCGCGCCCGTGAGGCGAAGCGCGCCGCGACCTATTGCTCCGCCCGCTGGGCCGA
GGACGCGGAAATCCGCGCGGCCGGACTGCTGGGCGAGGACGGCGTGGTGCTGGGCCGATACCGCCGGGCC
TATCTCCGGCATGATGGCCCCGAGCATGTCCTGACTTTCGCACCGACGCGCACGGGCAAAGGGGTAGGCA
TGGTGATCCCCACACTCCTGACCTGGCCGGGTTCGGCCATCATCCATGACATCAAGGGCGAGAACTGGCA
GATCACGGCCGGTTTCCGGAATCGCTTCGGGCGGGTGCTGCTGTTCGATCCCACCAATCCGGCGTCCTCG
GCCTACAACCCACTGCTGGAGGTGCGGCGCGGAGCGTCGGAGGTTCGTGACGTGCAGAACATCGCCGACA
TTCTGGTCGATCCCGAGGGTTCGCTGGAGCGCCGCAACCATTGGGAGAAAACCTCCCATGCCCTGCTGGT
CGGGGCGATCCTGCATGTGCTCTATGCCGAGGACGACAAGACGCTCGCCGGGGTGGCGAAATTCCTCTCT
GACCCGAAGCGGTCGATCGAGGCAACCCTGTCCGCCATGATGCGCACGAACCATCTGGACGGGAAGGGGC
CGCATCCCGTTGTGGCCTCGGCCGCACGGGAACTGCTGAACAAGTCGGATAACGAGCGCTCCGGCGTTCT
GTCCACCGCCATGTCGTTTCTTGGCCTCTACCGTGATCCGGTGGTGGCGACGGTGACCAGTCGCTGCGAA
TGGCGCATCGGCGACCTGCTGGAGGGCGACCAGCCCGTCTCCCTGTATTTCGTCATCCCGCCGTCGGATA
TCAGCCGCACCAAGCCGCTAATCCGCCTGATTCTCAACCAGATCGGGCGGCGGCTGACGGAGGATCTGTC
CGGTCGGGAGGGGCGGCGTCGCCTGCTGCTGATGCTCGACGAGTTTCCCGCCCTCGGCCGCCTGGACTTC
TTCGAGAGCGCGCTGGCCTTCATGGCGGGCTACGGGATCAAGGCGTTCCTGATTGCCCAAAGCCTAAACC
AGATCGACAAGGCCTACGGTCAGAACAACAGTATTCTCGACAACTGCCATGTCCGGGTTAGTTTCGCCAC
CAACGACGAGCGCACGGCGAAGCGCGTATCCGACGGGCTGGGCGTGGCCACCGAGATCCGCTCGCAGAAG
AACTATGCCGGGCACCGGCTGTCGCCTTGGCTCGGGCATCTCATGGTCTCGCGCCAGGAAAGTGCGCGGC
CTCTGATGACGGTGGGCGAAGTCATGCAGATCCCGGCACGGGAGGAAGTCGTCATGGTGGCGGGCTGTCC
ACCGATCCGGGCACGGAAGGCGCGGTATTTCCGGGATCGCCGCTTCGTCGAGCGCGTCCTGCCACCGCCC
GATCCGGCGCAGCTGCCACGGCCTGTCCGGCCCGATGACTGGAGTGGTCGTCCGTCTCCTGTCACCCCAC
CACCGGAGCAGACGGGGGCGCCGGCAGCACCGGATAAACCCGACGACGCCGATAGCGATGAATCGCTCGG
CACGGGGCGGAAATGGTCGCGCGAGCATGACCCGGCGGATATCGGCAAGCATAGAAAGCGCACGGTCCCC
GATCTCTTTGGTGAAGAACCGCCCCCGGATCCAGAAGCACGGGATCGCGCCGACCTGACACGGATTGCCC
GCCAGGCGGGCCTCGATCGCGGCAACGATCTCGGGCTGTGA
 Primer design