SecReT4
Protein ID: 162148678
T4SS name [ID]Trb [281]
Gene symboltrbI
Locus tagGDI_2906
StrainGluconacetobacter diazotrophicus PAl 5
Repliconchromosome [GenBank: NC_010125] [Browse all T4SS(s) in this replicon]
Location [Strand]2990338..2991474 [-]
Productconjugal transfer protein trbI
Component typeTrbI
UniProt IDA9HR69
KEGG IDgdi:GDI_2906
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 3.4e-56, Aligned region: 187..366
Protein Sequence: 378 a.a.     [Download]
>gi|162148678|ref|YP_001603139.1| conjugal transfer protein trbI [Gluconacetobacter diazotrophicus PAl 5]
MPDLRLRAERPRVVRLSRTVIWSLGGVGVVAVAFALGYALEASHRPPSAPAGPENASPPSAAGLDALPKD
YAGVPKLGPALPGDLGRPILHAQEQGKSVPTSAIGNEDARRAQQEIDAAIGSKLFAGIETRDQHEAQAMP
AMASGSADPNRDRADTRAQAGNRAFLAGQPDRQTVSPDRIMPVASPYVLQAGTVIAGALNTKISSDLPGQ
VVGHVTQNVYDSPTGRILLVPQGSTLFGAYNSGISFGQQRTQIIWTRLIFPNGESLVLEKLPGADAIGQS
GLSDEVNNHWGQLFKAALVTTLLSVGSEAGTSQSENNLAQAIRSGASNGFSMVGNRLVDRSLDIQPTLTD
RPGLPFTLVLSRDLVLKPYVKQGDNQHG
 
Nucleotide Sequence: 1137 bp     [Download]
>gi|162145846|ref|NC_010125.1|:c2991474-2990338 Gluconacetobacter diazotrophicus PAl 5 chromosome, complete genome
GTGCCTGACCTGCGTCTGAGGGCCGAACGGCCGCGCGTGGTGCGCCTGTCGCGGACCGTGATCTGGTCGC
TCGGCGGGGTCGGCGTCGTCGCCGTGGCGTTCGCTCTCGGCTATGCGCTGGAAGCCAGCCATCGACCGCC
GTCGGCGCCCGCCGGCCCGGAGAATGCGTCGCCGCCCTCGGCGGCGGGGCTGGACGCCCTGCCGAAAGAT
TATGCCGGCGTGCCGAAACTGGGACCGGCATTGCCCGGCGATCTCGGGCGACCAATCCTGCATGCGCAGG
AGCAGGGGAAGTCGGTCCCCACCAGTGCGATCGGCAACGAGGACGCGCGCCGGGCGCAGCAGGAGATCGA
CGCGGCCATCGGCAGCAAGCTCTTCGCCGGGATCGAGACCCGTGACCAGCATGAGGCTCAGGCGATGCCG
GCAATGGCCTCGGGATCAGCCGATCCCAATCGAGACCGTGCCGATACCCGAGCGCAGGCCGGAAACCGTG
CCTTCCTGGCAGGCCAGCCCGATCGCCAGACCGTCAGTCCCGACCGGATCATGCCGGTGGCGTCCCCCTA
TGTGCTTCAGGCCGGGACGGTGATCGCCGGCGCGCTGAACACCAAGATCAGTTCCGACCTCCCGGGGCAG
GTCGTCGGCCATGTAACCCAGAACGTGTATGACAGCCCGACCGGACGCATCCTGCTGGTTCCCCAGGGCA
GCACCCTGTTCGGCGCCTATAACAGCGGCATTTCGTTCGGGCAGCAGCGCACGCAGATCATCTGGACCCG
GCTGATCTTCCCGAACGGGGAGAGCCTGGTGCTGGAGAAGCTGCCGGGTGCGGACGCCATCGGTCAGTCG
GGTCTGTCGGACGAGGTGAACAACCATTGGGGCCAACTCTTCAAGGCCGCCCTGGTGACCACCCTGCTCA
GCGTTGGGTCGGAGGCGGGGACCAGCCAGAGCGAGAACAATCTCGCCCAGGCGATCCGAAGTGGAGCCAG
CAACGGATTTTCCATGGTCGGCAACCGGCTCGTGGATCGCTCGCTCGATATCCAGCCAACATTGACCGAT
CGGCCGGGGCTGCCGTTCACGCTGGTCCTGTCGAGGGACTTAGTCCTTAAGCCCTATGTGAAACAAGGAG
ATAACCAGCATGGATAA
 Primer design