SecReT4
Protein ID: 162148679
T4SS name [ID]Trb [281]
Gene symbolcagX
Locus tagGDI_2907
StrainGluconacetobacter diazotrophicus PAl 5
Repliconchromosome [GenBank: NC_010125] [Browse all T4SS(s) in this replicon]
Location [Strand]2991582..2992589 [-]
Productconjugal transfer protein
Component typeTrbG
UniProt IDA9HR72
KEGG IDgdi:GDI_2907
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.5e-65, Aligned region: 103..329
Protein Sequence: 335 a.a.     [Download]
>gi|162148679|ref|YP_001603140.1| conjugal transfer protein [Gluconacetobacter diazotrophicus PAl 5]
MIRLLMRALPLALLALSACTGRYHPPAIRYDDAVRATRLPNLPKPVQVVEVARPLPLPGQLKPLPMRRSR
PQHAAPEVADPTARVIQANVAARIQPTRAGFINAVQVYPYSPGALYQVYASPGEITDIMLQPGEKLVGSG
PVAAGDTVRWIIGDTSSGSGAAKRVHILVKPTRPDLTTNLIVNTDRRTYLAELRSTPSTYMASVSWDYPE
DDLIALRHQDSEAEDETPVATGLDLDDLHFRYAIQMVKGGTPPWLPSRAFDDGRKVYIAFPVGIGQGDLP
PLFVLGPDGNPALVNYRVRQNWMIVDRLFAAAELRLGDKTSEQRVRIVRTDGRPS
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|162145846|ref|NC_010125.1|:c2992589-2991582 Gluconacetobacter diazotrophicus PAl 5 chromosome, complete genome
ATGATCCGGCTGCTCATGCGCGCCTTGCCGCTGGCGCTGCTCGCCCTGTCCGCCTGCACCGGCCGGTACC
ATCCGCCTGCCATCCGTTATGACGACGCGGTGCGGGCAACCCGCCTGCCGAATCTACCGAAGCCGGTGCA
GGTCGTGGAGGTCGCACGACCACTGCCGTTGCCGGGGCAACTCAAACCCCTGCCAATGCGTCGTTCCCGA
CCGCAGCATGCTGCACCGGAGGTCGCCGACCCGACCGCGCGGGTCATTCAGGCGAATGTCGCCGCGCGCA
TTCAGCCGACACGGGCCGGATTCATCAACGCGGTGCAGGTTTATCCCTACAGTCCGGGCGCGCTCTATCA
GGTCTATGCTTCGCCCGGCGAGATCACCGACATTATGCTCCAGCCCGGCGAGAAACTGGTCGGCAGCGGT
CCGGTGGCGGCGGGCGATACCGTGCGCTGGATCATCGGCGACACCAGCAGCGGGAGCGGTGCCGCGAAAC
GCGTGCATATCCTGGTCAAGCCCACCCGGCCGGATCTCACCACCAATCTGATCGTCAACACGGACCGGCG
GACCTATCTGGCCGAACTGCGCTCGACCCCCTCGACCTACATGGCGTCGGTGTCGTGGGACTATCCAGAA
GATGACCTGATCGCCCTGCGCCATCAGGACAGCGAAGCCGAGGATGAGACACCGGTGGCGACGGGTCTCG
ATCTCGACGATCTGCATTTCCGCTACGCCATCCAGATGGTGAAAGGAGGGACCCCGCCCTGGTTGCCCAG
CCGGGCCTTCGATGACGGCCGGAAAGTCTATATCGCCTTTCCGGTCGGTATCGGGCAGGGGGATCTGCCG
CCGCTCTTCGTGCTGGGACCAGACGGTAACCCGGCACTGGTCAATTATCGCGTGCGCCAGAACTGGATGA
TCGTCGATCGGCTCTTCGCCGCGGCCGAACTGCGGCTTGGCGACAAGACCAGCGAGCAGCGGGTGCGCAT
TGTCCGCACCGATGGGCGGCCGTCATGA
 Primer design