SecReT4
Protein ID: 162148680
T4SS name [ID]Trb [281]
Gene symboltrbF
Locus tagGDI_2908
StrainGluconacetobacter diazotrophicus PAl 5
Repliconchromosome [GenBank: NC_010125] [Browse all T4SS(s) in this replicon]
Location [Strand]2992586..2993278 [-]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDA9HR74
KEGG IDgdi:GDI_2908
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.5e-55, Aligned region: 24..227
Protein Sequence: 230 a.a.     [Download]
>gi|162148680|ref|YP_001603141.1| conjugal transfer protein TrbF [Gluconacetobacter diazotrophicus PAl 5]
MTAMFRRSTTRYGDSPIPVTPYQQAAQLWDERIGSARVQARNWRYMAFGSLLLSAALGMALIQQAARGTI
VPWVVQVDHLGQAQVIGPATAAYVPTDPQVAWYLARFIEDVRGLSADPVVVRQNWLRAYDFTMIPGAQAL
NDYARLNDPFSRIGHEQVEVDVSSVIRASPSSFRVAWTERHYRDGAFTGTERWTAILTVLIAPPHNADRL
RKNPLGIYVTAINWSKELGQ
 
Nucleotide Sequence: 693 bp     [Download]
>gi|162145846|ref|NC_010125.1|:c2993278-2992586 Gluconacetobacter diazotrophicus PAl 5 chromosome, complete genome
ATGACCGCGATGTTCCGTCGCTCCACCACACGCTATGGCGACTCTCCAATCCCGGTGACGCCGTACCAGC
AGGCGGCCCAGCTCTGGGATGAGCGGATCGGGTCCGCCCGCGTCCAGGCCCGCAACTGGCGTTACATGGC
CTTCGGCTCGCTGCTCCTGTCCGCCGCCCTCGGCATGGCGCTGATCCAGCAGGCCGCCCGCGGCACCATC
GTGCCCTGGGTGGTGCAGGTCGATCATCTGGGGCAGGCCCAGGTGATCGGTCCCGCGACCGCCGCCTATG
TTCCCACCGATCCGCAGGTGGCGTGGTATCTGGCGCGCTTCATCGAGGATGTGCGCGGGCTTTCCGCCGA
CCCGGTCGTGGTCCGGCAGAACTGGCTGCGTGCCTACGACTTCACCATGATTCCCGGCGCGCAGGCGCTG
AACGATTATGCCCGCCTGAACGATCCCTTCTCACGGATCGGCCATGAGCAGGTTGAGGTGGATGTCTCGT
CCGTGATCCGGGCCTCGCCGTCTAGCTTCCGTGTCGCCTGGACCGAACGGCATTACCGTGACGGCGCCTT
CACCGGCACCGAGCGCTGGACCGCCATTCTCACCGTCCTGATCGCCCCGCCGCACAACGCCGACCGCCTG
CGGAAAAACCCGCTCGGTATCTACGTCACCGCCATCAACTGGTCGAAGGAACTCGGACAATGA
 Primer design