SecReT4
Protein ID: 162148681
T4SS name [ID]Trb [281]
Gene symboltrbL
Locus tagGDI_2909
StrainGluconacetobacter diazotrophicus PAl 5
Repliconchromosome [GenBank: NC_010125] [Browse all T4SS(s) in this replicon]
Location [Strand]2993275..2994741 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDA9HR76
KEGG IDgdi:GDI_2909
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.5e-43, Aligned region: 40..264
Protein Sequence: 488 a.a.     [Download]
>gi|162148681|ref|YP_001603142.1| conjugal transfer protein TrbL [Gluconacetobacter diazotrophicus PAl 5]
MDTSNVGIIDGFLNIFETTIDSGFGLVQGSVVSLAGSLSVMDVLLAGLFWAWAVDEDIIQRLVKKTLYVG
FFAFVINHFSTLAGIVFNSFATLGLRAGGGNLPLEDFMHPGRLAATGLSAAQPLLNAASKLAFSFGAIAS
IVQILVLLLCWFIVLAAFFILAVQLFVAIVEFKLTSLAGFVLIPFALFNRTAFLAEKVLGNVVSSGVKIM
VLAVISAIASVLFKQFTTSYGNTAPTVGQALSVVLASLCIAGLAIFGGSLANGLISGAPQLGAGAAVGTG
MAVGAMGAAAVAAPAAIALGGAAALGATAAAARGGAAIAGAATTAYSMGAAGQTGAAGVAAAAGNVGRAA
GGAAVNAVKSKAASAASSLKESYASGGQWAARGMGGGGSGSGGGAGSDPNSGGGASGAGPSGSGGGAPSG
GGPAGGGPSNDGSGGPEDAGSGADGKPPKWARNMKRRNAAAHAAEAAHVIRAADGGGGSSSIDLSEKE
 
Nucleotide Sequence: 1467 bp     [Download]
>gi|162145846|ref|NC_010125.1|:c2994741-2993275 Gluconacetobacter diazotrophicus PAl 5 chromosome, complete genome
ATGGATACAAGTAATGTCGGGATTATTGATGGATTCCTGAACATTTTCGAAACCACGATCGATTCCGGTT
TCGGTCTGGTGCAGGGCAGCGTCGTCTCGCTGGCCGGCTCTCTCTCGGTCATGGATGTGCTGCTGGCCGG
TCTGTTCTGGGCCTGGGCGGTGGACGAGGACATCATCCAGCGCCTGGTGAAGAAGACCCTCTATGTCGGC
TTCTTCGCCTTCGTCATCAATCATTTCAGCACGCTTGCCGGCATCGTCTTCAACAGTTTCGCCACACTCG
GCCTGCGGGCCGGTGGAGGAAACCTGCCGCTGGAAGATTTCATGCACCCGGGACGGCTGGCGGCGACCGG
GCTTTCGGCCGCGCAGCCGCTGCTCAATGCTGCCAGCAAACTGGCGTTTTCCTTCGGCGCTATTGCCAGC
ATCGTGCAGATTCTCGTGCTGCTCCTGTGCTGGTTCATCGTGCTGGCGGCCTTCTTCATTCTGGCCGTGC
AACTGTTCGTGGCCATCGTCGAATTCAAACTGACATCGCTTGCAGGCTTCGTGCTGATCCCGTTCGCCCT
GTTCAATCGCACGGCCTTCCTCGCCGAGAAGGTGCTGGGCAATGTCGTCTCGTCCGGCGTGAAGATCATG
GTGCTCGCGGTCATCTCCGCCATCGCCTCCGTTCTCTTCAAGCAATTCACGACCTCCTACGGGAACACTG
CGCCGACCGTCGGGCAGGCGCTGTCCGTGGTGCTGGCCTCGCTGTGCATCGCGGGCCTTGCGATCTTCGG
TGGGTCTCTCGCCAACGGGCTGATCTCTGGCGCGCCGCAGCTTGGTGCCGGGGCTGCCGTCGGAACCGGA
ATGGCCGTCGGTGCGATGGGCGCCGCTGCCGTCGCGGCTCCGGCGGCGATCGCGTTGGGAGGTGCGGCAG
CACTCGGCGCCACGGCGGCGGCCGCGCGGGGAGGGGCCGCAATCGCGGGTGCTGCGACCACCGCCTACTC
CATGGGGGCCGCCGGACAAACCGGTGCGGCTGGCGTGGCCGCCGCCGCCGGTAATGTCGGTCGCGCGGCG
GGTGGTGCGGCGGTGAACGCCGTGAAGAGCAAGGCCGCCTCCGCCGCCTCGTCCCTGAAGGAAAGCTACG
CCTCCGGCGGTCAATGGGCCGCGCGCGGCATGGGCGGAGGAGGCAGCGGCTCTGGCGGAGGCGCTGGCAG
TGATCCGAACTCTGGTGGCGGCGCTTCCGGCGCGGGACCGTCCGGCTCTGGCGGTGGCGCTCCTTCGGGC
GGTGGTCCGGCCGGTGGCGGGCCGTCGAATGACGGTAGCGGAGGACCGGAGGACGCTGGCTCCGGCGCGG
ACGGCAAGCCGCCGAAATGGGCGCGGAACATGAAACGTCGCAATGCCGCCGCCCATGCCGCCGAGGCAGC
CCATGTCATCCGCGCGGCCGATGGCGGCGGCGGATCGTCCTCGATCGATCTCTCGGAAAAGGAATGA
 Primer design