SecReT4
Protein ID: 162148682
T4SS name [ID]Trb [281]
Gene symboltrbJ
Locus tagGDI_2910
StrainGluconacetobacter diazotrophicus PAl 5
Repliconchromosome [GenBank: NC_010125] [Browse all T4SS(s) in this replicon]
Location [Strand]2994745..2995455 [-]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDA9HR79
KEGG IDgdi:GDI_2910
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 236 a.a.     [Download]
>gi|162148682|ref|YP_001603143.1| conjugal transfer protein TrbJ [Gluconacetobacter diazotrophicus PAl 5]
MLAIGGAFSPLHPAHAQWAVYDGANLVENVLIAARTLQQIDNQITSLTNQAQMLVNQGRNLASLPLSTLG
TLQSTISQTTALLAQAQNIAYSVQSVEQQYQQAYTSISSGMSDSTLFSQAQTRWQNSVAGLEDALKLQAR
VVGNIPSDSSAMTQLVSASQTSTGALQAAQAGNQLMALQSRQLSDIQAELAANGRAAELERARQAANEAG
AEAQYQHFAHYDAYVPEAVSIPGSGN
 
Nucleotide Sequence: 711 bp     [Download]
>gi|162145846|ref|NC_010125.1|:c2995455-2994745 Gluconacetobacter diazotrophicus PAl 5 chromosome, complete genome
ATGCTGGCGATTGGAGGGGCGTTTTCTCCTTTGCATCCGGCTCATGCTCAGTGGGCGGTCTATGACGGGG
CGAACCTCGTCGAGAATGTGCTGATTGCGGCTCGTACCCTTCAGCAGATCGACAACCAGATCACCTCTCT
CACCAATCAGGCGCAGATGCTGGTCAATCAGGGGCGCAACCTGGCGAGCCTTCCGCTCTCCACATTGGGC
ACGCTGCAATCCACCATTTCCCAGACGACGGCATTGCTCGCGCAGGCGCAGAACATCGCCTACAGCGTCC
AGTCGGTCGAGCAGCAATATCAGCAGGCGTACACCTCCATATCCTCGGGCATGTCCGACAGCACCCTGTT
TTCTCAGGCGCAGACGCGGTGGCAGAATTCCGTGGCTGGCCTCGAGGATGCGCTGAAGCTCCAGGCGCGC
GTCGTGGGCAACATTCCGAGCGACAGCAGCGCGATGACGCAGCTTGTCTCGGCCAGCCAGACCTCCACCG
GAGCGTTGCAGGCGGCGCAGGCGGGCAATCAGCTTATGGCCCTGCAATCCCGCCAGCTATCCGACATTCA
GGCTGAACTCGCCGCCAATGGACGGGCGGCCGAACTGGAGCGTGCGCGGCAGGCCGCCAACGAAGCCGGC
GCCGAAGCTCAGTACCAGCATTTCGCCCATTATGACGCCTACGTGCCCGAGGCCGTCTCGATACCCGGTT
CGGGAAACTGA
 Primer design