SecReT4
Protein ID: 162148683
T4SS name [ID]Trb [281]
Gene symboltrbE
Locus tagGDI_2911
StrainGluconacetobacter diazotrophicus PAl 5
Repliconchromosome [GenBank: NC_010125] [Browse all T4SS(s) in this replicon]
Location [Strand]2995542..2997977 [-]
Productconjugal transfer ATPase TrbE
Component typeTrbE
UniProt IDA9HR81
KEGG IDgdi:GDI_2911
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 5.5e-35, Aligned region: 442..715
CagE_TrbE_VirB [PF03135], Evalue: 2.6e-10, Aligned region: 182..388
Protein Sequence: 811 a.a.     [Download]
>gi|162148683|ref|YP_001603144.1| conjugal transfer ATPase TrbE [Gluconacetobacter diazotrophicus PAl 5]
MMSLGEYRNRAALLSDYLPWAALVERGVVLNKDGSFQRTARIRGPDLDSATPAELVGVTGRLNNALRRLG
SGWAVFVEAQRVPATLYPESDFPDAASQMVDLERREQFEDEGAHFESRYFLTLVWLPPAESANRAARFLF
EGRERDGPDPHGMLHTFVDRSDRLLALLDGFMPEAAWLDDGETLTYLHSTISTRNQRVRVPEIPMHLDAL
LVDQPLAGGLEPKLGDAYLKTLTITGFPSRTFPGILDDLNRLAMPYRWSTRAILLDKTDATKVLTKIRRQ
WFAKRKSIAAIVREVMTNEASVLVDNDAANKAADADLALQSLGADDVGQAYITATVTVWDGSVSIAAEKL
RLVEKIIQGRDFTCMTESLNAVEAWLGSLPGHVYANVRQPPVSTLNLAHMIPLSAVWAGPDRDVHFKAPP
LFYGKTAGATPFRFSLHASDVGHTLIAGPTGAGKSVLLALMALQFRRYMGAQIFAFDFGGSMRAATLGMG
GDWHDLGGGLTEDQADGVPAVSLQPLARIDDPDERKWASEWLGQILVGEGVSLTPEVKSYLWSALNSLTS
SPVQERTLSGLVALLQSNALKQALAPYCLGGPYGRLLDADNERLGDADVVVFETEGLIGSGAASSVLSYL
FHRIEGRLDGRPTLLVIDEGWLVLDDGNFSGQLREWLKTLRKKNASVIFATQSLSDIANSPIAPAVVESC
PTRIFLPNERAIEPQIMAIYRDFGLNDRQIAIIARAASKREYYCQTQRGNRLFELGLGPVALTLCAASGK
DDHKLIDQMLAEHGRAGFLPAWFETRGVSWAADLLRDGGVP
 
Nucleotide Sequence: 2436 bp     [Download]
>gi|162145846|ref|NC_010125.1|:c2997977-2995542 Gluconacetobacter diazotrophicus PAl 5 chromosome, complete genome
ATGATGTCCCTTGGCGAATACCGCAACCGAGCCGCTCTCCTGTCCGATTACCTGCCATGGGCGGCGCTGG
TCGAACGCGGCGTGGTGCTGAACAAGGACGGTTCCTTCCAGCGCACCGCGCGCATTCGTGGCCCCGATCT
TGATTCGGCCACGCCCGCCGAATTGGTGGGTGTGACCGGCCGTCTCAACAACGCCCTGCGCCGTCTCGGC
TCCGGCTGGGCGGTGTTCGTCGAGGCGCAACGTGTGCCCGCGACCCTCTACCCGGAGAGCGATTTCCCCG
ATGCCGCCAGCCAGATGGTCGATCTGGAGCGGCGGGAGCAGTTCGAGGATGAGGGGGCGCATTTCGAGAG
CCGCTATTTTCTGACCTTGGTCTGGCTCCCCCCGGCAGAAAGCGCCAATCGGGCGGCCAGGTTCCTGTTC
GAAGGTCGGGAGCGCGACGGTCCCGACCCGCACGGCATGCTCCATACGTTCGTGGATCGCAGCGATCGTC
TGCTGGCTCTGCTGGACGGGTTCATGCCGGAGGCCGCCTGGCTCGATGACGGCGAAACCCTGACCTACCT
GCATTCCACTATTTCCACGCGCAACCAGCGGGTCCGCGTGCCGGAAATTCCGATGCACCTTGACGCCCTG
CTGGTGGACCAGCCGCTCGCGGGTGGTCTGGAACCGAAACTCGGTGATGCGTATCTGAAAACCCTGACCA
TCACCGGTTTCCCGAGCCGGACCTTCCCCGGGATCCTCGACGATCTGAATCGCCTCGCCATGCCCTATCG
CTGGTCCACGCGGGCGATCTTGCTCGACAAGACGGACGCCACCAAGGTTCTGACGAAGATCCGGCGGCAG
TGGTTCGCAAAGCGCAAGAGCATTGCAGCCATTGTCCGCGAGGTGATGACCAACGAGGCATCGGTGCTGG
TGGACAACGACGCCGCCAACAAAGCCGCCGACGCCGATCTGGCATTGCAGTCGCTCGGGGCCGACGATGT
GGGCCAAGCCTATATCACCGCCACCGTCACGGTCTGGGATGGTTCTGTCAGCATCGCGGCGGAGAAATTG
CGTCTGGTGGAGAAAATCATCCAGGGGCGCGACTTCACCTGCATGACCGAGAGTCTGAACGCCGTGGAAG
CATGGCTCGGCTCTTTGCCCGGCCATGTTTACGCGAACGTCCGGCAACCGCCGGTCTCCACGCTGAATCT
GGCGCATATGATTCCGCTCTCCGCCGTCTGGGCGGGGCCGGACCGGGATGTGCATTTCAAGGCGCCGCCG
CTCTTCTACGGCAAGACCGCCGGGGCCACGCCGTTCCGGTTTTCTCTCCATGCCAGTGACGTAGGGCACA
CGCTGATCGCGGGGCCGACAGGAGCAGGGAAATCCGTGCTGCTGGCGCTGATGGCATTGCAGTTCCGCCG
GTATATGGGAGCGCAGATCTTCGCCTTCGATTTCGGTGGCTCCATGCGCGCCGCCACGCTCGGCATGGGC
GGAGACTGGCACGATCTCGGGGGCGGTCTGACGGAGGATCAGGCTGATGGTGTTCCCGCCGTCTCGCTCC
AGCCGCTGGCGCGGATCGATGACCCGGACGAACGCAAATGGGCCAGCGAATGGCTCGGCCAGATCCTTGT
CGGCGAGGGCGTATCGCTCACGCCGGAGGTGAAGTCCTACCTCTGGTCAGCGCTGAATTCCCTGACGTCA
TCGCCGGTTCAGGAGCGGACCCTGTCCGGTCTGGTAGCGTTGCTCCAATCCAACGCGCTCAAGCAGGCTC
TTGCCCCATACTGCCTTGGCGGTCCTTACGGACGGCTCCTTGACGCCGATAATGAGCGTCTGGGGGATGC
CGATGTCGTGGTGTTCGAGACCGAAGGGTTGATCGGTTCGGGTGCCGCGTCTTCCGTGCTGTCCTACCTG
TTCCACCGCATCGAAGGCCGCCTGGATGGCCGACCGACCCTGCTGGTGATCGACGAGGGATGGCTTGTTC
TGGACGACGGGAATTTCTCCGGTCAGTTGCGGGAGTGGCTGAAAACCCTGCGCAAGAAAAATGCCAGCGT
CATCTTCGCCACGCAGTCCCTGTCGGACATCGCAAACTCACCCATCGCGCCAGCCGTGGTCGAAAGCTGC
CCGACCCGGATCTTCCTGCCGAACGAGCGGGCGATCGAGCCGCAGATTATGGCCATCTATCGCGACTTCG
GTCTGAACGATCGCCAGATCGCCATTATCGCCCGCGCCGCGTCGAAGCGGGAGTATTACTGCCAGACCCA
GCGTGGCAACCGCCTGTTCGAACTTGGGCTTGGTCCGGTGGCGCTGACGCTGTGCGCGGCCTCCGGCAAG
GACGATCATAAACTGATCGACCAGATGCTCGCGGAACACGGGCGTGCCGGATTTCTGCCCGCGTGGTTCG
AGACGCGCGGCGTGTCCTGGGCGGCCGACCTCCTGCGGGACGGAGGCGTGCCATGA
 Primer design