SecReT4
Protein ID: 162148684
T4SS name [ID]Trb [281]
Gene symboltrbD
Locus tagGDI_2912
StrainGluconacetobacter diazotrophicus PAl 5
Repliconchromosome [GenBank: NC_010125] [Browse all T4SS(s) in this replicon]
Location [Strand]2997991..2998266 [-]
Productconjugal transfer protein trbD
Component typeTrbD
UniProt IDA9HR83
KEGG IDgdi:GDI_2912
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 8.1e-10, Aligned region: 5..85
Protein Sequence: 91 a.a.     [Download]
>gi|162148684|ref|YP_001603145.1| conjugal transfer protein trbD [Gluconacetobacter diazotrophicus PAl 5]
MAGYDDDAVPGFHVPVHRSLTDPILLGGAPRTLAIANGTLGAAISLGLRLWLVGAVFWIVGHSLAVWGAK
RDPLFVEVGRRHLRYPAWLRT
 
Nucleotide Sequence: 276 bp     [Download]
>gi|162145846|ref|NC_010125.1|:c2998266-2997991 Gluconacetobacter diazotrophicus PAl 5 chromosome, complete genome
ATGGCGGGATATGACGATGACGCGGTGCCGGGCTTCCATGTCCCGGTGCATCGCTCCCTGACCGACCCGA
TCCTGCTGGGCGGGGCACCCCGCACGTTGGCGATCGCCAACGGCACGCTGGGCGCGGCCATCTCGCTCGG
CCTGCGGCTCTGGCTGGTCGGCGCGGTATTCTGGATTGTCGGGCACAGCCTTGCGGTCTGGGGTGCCAAG
CGCGATCCGTTGTTCGTGGAGGTCGGGCGGCGGCATCTCCGCTACCCCGCCTGGCTCCGGACGTGA
 Primer design