SecReT4
Protein ID: 162148685
T4SS name [ID]Trb [281]
Gene symboltrbC
Locus tagGDI_2913
StrainGluconacetobacter diazotrophicus PAl 5
Repliconchromosome [GenBank: NC_010125] [Browse all T4SS(s) in this replicon]
Location [Strand]2998266..2998622 [-]
Productconjugal transfer protein trbC
Component typeTrbC
UniProt IDA9HR85
KEGG IDgdi:GDI_2913
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 9.1e-23, Aligned region: 18..108
Protein Sequence: 118 a.a.     [Download]
>gi|162148685|ref|YP_001603146.1| conjugal transfer protein trbC [Gluconacetobacter diazotrophicus PAl 5]
MMSQTLSARIFVSAPASRLSRLTSMAGIALFAATSSAWASGSGMPWEEPLNQILESIQGPVARIVSVIII
TVTGLTLAFGETSGGFRRLIQIVFGLSIAFAASSFFLSFFSFSGGALI
 
Nucleotide Sequence: 357 bp     [Download]
>gi|162145846|ref|NC_010125.1|:c2998622-2998266 Gluconacetobacter diazotrophicus PAl 5 chromosome, complete genome
GTGATGTCGCAGACCCTGTCCGCGCGCATTTTCGTAAGCGCGCCCGCCAGCCGCCTCTCCCGTCTGACCA
GCATGGCCGGGATCGCCCTGTTCGCCGCAACCTCGTCAGCCTGGGCCTCCGGGTCCGGCATGCCGTGGGA
GGAACCGCTCAACCAGATCCTGGAATCCATCCAGGGGCCGGTGGCACGCATCGTCTCGGTGATCATCATC
ACCGTGACCGGCCTGACCCTGGCCTTCGGGGAAACGTCGGGCGGCTTCCGACGCCTGATCCAGATCGTCT
TTGGCCTCTCCATCGCCTTCGCGGCGTCGAGCTTCTTCCTCTCTTTCTTCAGCTTCAGCGGCGGGGCGCT
GATCTGA
 Primer design