SecReT4
Protein ID: 162148686
T4SS name [ID]Trb [281]
Gene symboltrbB
Locus tagGDI_2914
StrainGluconacetobacter diazotrophicus PAl 5
Repliconchromosome [GenBank: NC_010125] [Browse all T4SS(s) in this replicon]
Location [Strand]2998619..2999674 [-]
Productconjugal transfer protein trbB
Component typeTrbB
UniProt IDA9HR88
KEGG IDgdi:GDI_2914
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 5.7e-86, Aligned region: 35..300
FtsK_SpoIIIE [PF01580], Evalue: 3.7e-05, Aligned region: 156..189
AAA_16 [PF13191], Evalue: 4.6e-05, Aligned region: 150..236
Protein Sequence: 351 a.a.     [Download]
>gi|162148686|ref|YP_001603147.1| conjugal transfer protein trbB [Gluconacetobacter diazotrophicus PAl 5]
MPGWLNATGTIMRTSAHHAGAAARSVSMLRTAMGRPIAAHLADPAVVEVMLNPDGRLWVDRLSEGLADTG
DTISPADAERILRLVAHHVGAEVHEAAPRVSAELPTGERFEGLLPPVVTAPSFAIRKPAVAVFTLNDYVD
ARIMTAAQASFLRRAVAGRQNIVVAGGTSTGKTTLVNALLAELAKTTDRVVLIEDTRELQCTASNLIALR
TRDGVVTLSELVRSALRLRPDRIPIGEVRGPEALDLLKAWGTGHPGGVGTLHAGTALGALRRLEQLIQEI
VVTVPRALIAETIDVIAVLSGRGAARRLSELATVDALDPVSGDYRISPFEAPSAQGPCPGPSNLSSLKDR
E
 
Nucleotide Sequence: 1056 bp     [Download]
>gi|162145846|ref|NC_010125.1|:c2999674-2998619 Gluconacetobacter diazotrophicus PAl 5 chromosome, complete genome
TTGCCCGGATGGCTCAACGCCACGGGGACCATTATGCGGACATCCGCTCACCACGCAGGTGCGGCCGCGC
GGAGCGTTTCCATGCTGCGCACGGCCATGGGGCGGCCCATCGCCGCGCATCTGGCAGATCCGGCTGTGGT
CGAAGTCATGCTCAATCCGGATGGTCGGTTGTGGGTCGACCGGCTGTCCGAGGGACTCGCCGACACAGGC
GATACCATCTCCCCGGCCGATGCCGAGCGCATCTTGCGGCTGGTCGCGCATCATGTCGGGGCTGAGGTGC
ATGAGGCAGCACCGCGCGTATCGGCGGAACTGCCGACGGGAGAGCGGTTCGAAGGTCTGCTGCCTCCGGT
GGTGACAGCGCCGAGCTTTGCGATCCGCAAACCGGCCGTCGCCGTGTTCACCCTCAACGATTACGTCGAC
GCCCGAATCATGACAGCGGCGCAGGCGAGCTTTCTGCGCCGGGCGGTCGCTGGGCGGCAGAATATCGTGG
TCGCGGGCGGGACTTCGACCGGCAAGACCACGCTGGTCAATGCCCTGCTGGCCGAATTGGCCAAGACTAC
CGACCGCGTGGTGCTGATCGAGGACACCCGCGAATTGCAATGCACCGCGTCCAACCTGATCGCGCTGCGC
ACCCGTGACGGGGTGGTCACTCTGTCCGAGCTGGTGCGCTCCGCCTTGCGGTTGCGGCCCGACCGGATTC
CGATCGGTGAGGTGCGCGGTCCGGAGGCGCTCGATCTCCTCAAGGCCTGGGGTACCGGTCATCCCGGCGG
CGTGGGCACGCTGCACGCCGGCACGGCGCTGGGTGCGCTGCGGCGGCTGGAGCAACTGATCCAGGAGATC
GTCGTGACCGTACCCCGCGCGCTGATTGCCGAGACGATCGACGTGATCGCGGTCCTCTCCGGGCGCGGCG
CCGCGCGTCGGCTGTCCGAACTGGCCACGGTCGATGCGCTCGACCCGGTGAGCGGCGACTACCGGATCTC
TCCCTTCGAGGCGCCGTCCGCACAGGGACCGTGCCCAGGCCCTTCCAACCTTTCCAGCCTCAAGGATCGT
GAGTGA
 Primer design