SecReT4
Protein ID: 162148689
T4SS name [ID]Trb [281]
Gene symboltraG
Locus tagGDI_2917
StrainGluconacetobacter diazotrophicus PAl 5
Repliconchromosome [GenBank: NC_010125] [Browse all T4SS(s) in this replicon]
Location [Strand]3001295..3003316 [-]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDA9HR95
KEGG IDgdi:GDI_2917
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 8.6e-96, Aligned region: 112..556
TraG-D_C [PF12696], Evalue: 1.7e-30, Aligned region: 402..524
TrwB_AAD_bind [PF10412], Evalue: 9.8e-22, Aligned region: 146..537
AAA_10 [PF12846], Evalue: 6.5e-06, Aligned region: 147..479
Protein Sequence: 673 a.a.     [Download]
>gi|162148689|ref|YP_001603150.1| conjugal transfer coupling protein TraG [Gluconacetobacter diazotrophicus PAl 5]
MSGSRILWGQLCLCFLIVVVAWWTATQWVAWRLAFQPELGSPWTLVAGRWPVYAPFLFPWWWYEFDAYAP
HIFVEGAWIAGSGGVLAFLVAVFLSVWRARERKRTATYGSARWAERHDVEEAGLLSPDGVVLGRWGRDYL
RHDGPEHVLCFGPTRSGKGVGLVVPTLLTWPGSAVVHDIKGENWSITAGFRGRFGRLILFDPTNPDSCGY
NPLLEIRLGEWEVRDAQNVADVLVDPEGSLERRNHWEKTSHSLLVGAILHVLYAEPDKSLRGVANLLSDP
KRSIAATLVVMMGTRHLGERGVHPVVASAARELLNKSPNERSGVLSTAMSFLGLYRDPVVADVTSRSAWR
IGDLVDAARPTTLYFVIPPSDISRTKPLIRLMLNQIGRRLTEDLSGAGGRQRLLLMLDEFAALGRLDFFE
SALAFMAGYRIKAFLIAQSLNQIDKAYGDKNSIMDNCHVRVSFATNDDRTAKRVSDALGTATEVRSQKNY
AGHRLSPWLGHLMVSRQESARPLLTVGEVQELPRTDELVLVSGISPIRAKKASYFRDARFQERLLPAPKT
GTRGLSVLPDDWTGRPQPAKPEVRPDTPEDAVKEAAGDEDPVGTEARRQPEMDVAREPDLPPQDDGDPVH
EPHRRDRERDPAEEEDLHAVLTADLARKARQAALDPGNDLGIS
 
Nucleotide Sequence: 2022 bp     [Download]
>gi|162145846|ref|NC_010125.1|:c3003316-3001295 Gluconacetobacter diazotrophicus PAl 5 chromosome, complete genome
ATGTCTGGTTCTCGTATCCTGTGGGGGCAGCTCTGCCTCTGCTTCCTAATTGTCGTCGTGGCGTGGTGGA
CCGCGACCCAATGGGTCGCCTGGCGGTTGGCGTTCCAGCCCGAACTCGGTTCGCCCTGGACTCTCGTCGC
CGGTCGCTGGCCGGTCTATGCGCCGTTCCTGTTCCCCTGGTGGTGGTACGAATTCGACGCTTACGCGCCG
CATATCTTCGTCGAGGGCGCGTGGATCGCGGGATCGGGTGGCGTTCTGGCGTTCCTGGTCGCCGTGTTCC
TGTCGGTCTGGCGGGCGCGCGAGCGTAAGCGCACCGCCACCTATGGGTCGGCGCGCTGGGCGGAGCGTCA
CGATGTCGAGGAGGCGGGGCTTCTTTCGCCGGACGGCGTGGTATTGGGGCGTTGGGGGCGCGACTATCTG
CGTCATGATGGTCCGGAGCATGTGCTGTGCTTCGGGCCGACCCGATCCGGTAAGGGTGTCGGCTTAGTCG
TGCCGACCCTGCTGACCTGGCCGGGCTCCGCCGTCGTCCACGACATCAAGGGGGAGAACTGGTCGATCAC
GGCGGGGTTTCGCGGGCGTTTCGGGCGTCTGATTCTGTTCGACCCGACGAACCCGGACTCGTGTGGCTAC
AATCCGCTGCTTGAAATACGCCTCGGCGAATGGGAAGTCCGTGACGCCCAGAATGTCGCCGACGTGCTGG
TCGATCCCGAGGGATCGCTGGAACGACGCAACCACTGGGAGAAGACGTCGCATTCGCTGCTGGTCGGGGC
CATCCTCCACGTCCTGTATGCCGAACCGGACAAGTCGCTGCGCGGGGTGGCTAACCTGCTGTCCGATCCC
AAGCGATCCATCGCGGCCACGCTCGTGGTCATGATGGGCACGCGCCACCTCGGCGAGCGCGGCGTCCACC
CGGTAGTGGCGTCTGCCGCGCGCGAATTGCTCAACAAATCCCCCAACGAACGCTCCGGCGTGCTGAGCAC
CGCCATGTCCTTTCTCGGCCTGTATCGCGACCCCGTCGTGGCGGACGTTACCAGTCGCAGCGCCTGGCGG
ATCGGCGATCTGGTCGACGCGGCGCGGCCGACCACGCTCTATTTCGTCATCCCGCCGTCGGACATCAGCC
GCACCAAGCCGCTGATCCGCCTGATGCTCAACCAGATCGGGCGGAGATTGACCGAAGATCTCTCCGGCGC
GGGGGGGCGACAACGATTGCTGCTGATGCTCGACGAGTTCGCAGCGCTGGGGCGGCTGGATTTCTTCGAA
AGCGCGCTCGCCTTCATGGCCGGGTATCGGATCAAGGCGTTCCTGATCGCCCAGTCACTCAACCAGATCG
ACAAGGCCTACGGCGACAAGAATTCGATCATGGACAATTGTCATGTCCGCGTCAGCTTCGCGACCAATGA
CGACCGTACGGCCAAGCGTGTCTCGGACGCGCTGGGCACTGCCACCGAAGTCCGTTCACAGAAGAACTAC
GCCGGCCATCGCCTCTCGCCTTGGCTCGGACACCTCATGGTGTCGCGTCAGGAGAGCGCGCGCCCGCTGT
TGACCGTCGGTGAGGTCCAGGAACTGCCGCGCACGGATGAACTCGTTCTGGTGTCTGGCATATCGCCGAT
CCGGGCGAAGAAGGCTTCCTATTTCCGCGACGCCCGGTTTCAGGAGCGGCTGTTGCCGGCCCCCAAGACT
GGAACCCGTGGGCTGTCGGTCTTGCCGGACGACTGGACAGGGCGCCCGCAGCCAGCGAAGCCGGAGGTCA
GGCCCGATACCCCGGAGGATGCGGTCAAGGAAGCGGCCGGGGACGAAGATCCGGTCGGAACCGAGGCGCG
CCGTCAGCCGGAAATGGACGTGGCACGCGAACCAGACCTGCCACCGCAGGATGATGGCGACCCGGTCCAC
GAGCCGCACAGGCGCGATCGTGAGCGGGACCCGGCCGAAGAGGAAGACCTTCACGCCGTGCTGACGGCGG
ATCTGGCGCGCAAGGCGCGTCAGGCCGCACTCGATCCCGGCAATGATCTGGGGATTTCGTGA
 Primer design