SecReT4
Protein ID: 16262955
T4SS name [ID]VirB [196]
Gene symboltraG
Locus tagSMa0929
StrainSinorhizobium meliloti 1021
Repliconplasmid pSymA [GenBank: NC_003037] [Browse all T4SS(s) in this replicon]
Location [Strand]513088..515007 [-]
Productconjugal transfer protein TraG
Component typeVirD4
UniProt IDQ92ZI3
KEGG IDsme:SMa0929
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 7e-97, Aligned region: 169..635
TraG-D_C [PF12696], Evalue: 3.3e-30, Aligned region: 473..596
TrwB_AAD_bind [PF10412], Evalue: 1.3e-21, Aligned region: 428..612
Protein Sequence: 639 a.a.     [Download]
>gi|16262955|ref|NP_435748.1| conjugal transfer protein TraG [Sinorhizobium meliloti 1021]
MALKAKPHPSLLVILFPVAVTAAAVYVVGWRWPGLAAGMSGKTAYWFLRAAPVPALLFGPLAGLLAVWAL
PLHRRRPVAMASLACFLTVAGFYALREFGRLSPSVESGALSWDRALSYLDMVAVVGAVVGFMAVAVSARI
STVVPEPVKRAKRGTFGDADWLPMAAAGKLFPPDGEIVIGERYRVDKDIVHELPFEPNDPATWGQGGKAP
LLTYRQDFDSTHMLFFAGSGGYKTTSNVVPTALRYTGPLICLDPSTEVAPMVVEHRTRVLGREVMVLDPT
NPIMGFNVLDGIEHSRQKEEDIVGIAHMLLSESVRFESSTGSYFQNQAHNLLTGLLAHVMLSPEYAGRRT
LRSLRQIVSEPEPSVLAMLRDIQERSASTFIRETLGVFTNMTEQTFSGVYSTASKDTQWLSLDSYAALVC
GNAFKSSDIVSGKKDVFLNIPASILRSYPGIGRVIIGSLINAMIQADGSFKRRALFMLDEVDLLGYMRLL
EEARDRGRKYGISMMLLYQSLGQLERHFGRDGAVSWIDGCAFASYAAVKALDTARNISAQCGEMTVEVKG
SSRNIGWDTKNSASRKSENVNYQRRPLIMPHEITQSMRKDEQIIIVQGHSPIRCGRAIYFRRKDMNEAAK
ANRFVKAIP
 
Nucleotide Sequence: 1920 bp     [Download]
>gi|16262453|ref|NC_003037.1|:c515007-513088 Sinorhizobium meliloti 1021 plasmid pSymA, complete sequence
ATGGCACTGAAGGCAAAACCGCATCCGAGCCTGTTGGTCATTCTCTTTCCCGTCGCCGTCACCGCCGCTG
CCGTCTATGTCGTCGGCTGGCGCTGGCCGGGGCTCGCCGCCGGCATGTCGGGGAAGACGGCATATTGGTT
CCTGCGGGCGGCGCCCGTGCCAGCGCTACTGTTCGGGCCGCTCGCCGGCCTGTTGGCCGTTTGGGCCTTG
CCATTGCACCGGCGAAGGCCAGTCGCAATGGCGAGCCTCGCCTGTTTTCTGACGGTCGCGGGCTTCTACG
CGCTCCGTGAATTCGGCCGGCTGTCCCCCTCCGTGGAAAGCGGTGCGCTATCATGGGACCGGGCGCTGTC
CTACCTCGACATGGTCGCTGTCGTCGGCGCGGTCGTTGGCTTTATGGCCGTCGCTGTCTCCGCGCGCATC
TCCACCGTCGTGCCCGAACCGGTAAAGCGCGCTAAGCGCGGAACCTTCGGTGACGCGGACTGGCTGCCGA
TGGCGGCGGCGGGAAAGCTGTTTCCGCCGGACGGCGAGATCGTCATCGGGGAGCGCTACCGCGTCGACAA
GGACATTGTCCACGAACTGCCCTTCGAGCCAAACGATCCGGCGACTTGGGGCCAAGGCGGCAAGGCCCCT
TTGCTGACCTACCGCCAGGACTTCGATTCCACCCATATGCTGTTCTTTGCGGGCTCGGGTGGATACAAGA
CGACCAGCAACGTCGTGCCGACGGCGCTGCGTTATACCGGGCCGCTCATCTGCCTCGATCCGTCGACCGA
GGTCGCGCCCATGGTGGTCGAGCACCGAACCCGCGTGCTCGGCCGCGAGGTGATGGTTCTTGATCCGACG
AACCCGATCATGGGCTTCAACGTGCTCGACGGGATCGAGCACTCACGGCAAAAGGAAGAGGACATCGTCG
GCATTGCCCACATGCTGCTGTCAGAAAGCGTGCGCTTCGAAAGCTCGACCGGCTCCTACTTCCAGAACCA
GGCGCACAATCTCCTGACCGGTCTGCTCGCCCATGTGATGCTGTCGCCCGAATATGCCGGACGGCGGACG
TTACGCAGTCTCCGGCAGATCGTATCCGAGCCAGAGCCGTCGGTGCTGGCGATGCTGCGTGACATTCAGG
AGCGTTCCGCGTCCACTTTCATCCGCGAAACGCTCGGCGTCTTCACCAATATGACCGAGCAGACTTTTTC
GGGCGTCTACTCGACGGCGTCGAAGGATACGCAGTGGCTGTCGCTCGACAGCTACGCCGCGCTCGTTTGC
GGCAATGCGTTCAAGTCGAGCGATATCGTCTCGGGCAAGAAGGACGTGTTCCTGAACATCCCCGCGTCGA
TCCTGCGCTCCTATCCGGGCATCGGCCGCGTCATCATCGGCTCGCTGATCAATGCCATGATCCAGGCCGA
TGGCTCATTCAAGCGCCGGGCGTTGTTCATGTTGGATGAGGTCGATCTCCTCGGCTACATGCGCCTCCTC
GAGGAGGCACGCGACCGCGGCCGCAAGTACGGCATCAGCATGATGCTGCTGTACCAATCCCTAGGGCAGC
TGGAGCGGCATTTCGGGAGGGACGGTGCGGTGTCGTGGATCGACGGATGCGCCTTCGCCTCCTATGCCGC
GGTTAAGGCGCTGGACACGGCGCGCAACATTTCGGCGCAATGCGGAGAAATGACGGTTGAGGTAAAAGGA
AGCTCCCGCAATATCGGCTGGGACACGAAGAACAGCGCATCGCGCAAATCGGAAAACGTCAATTACCAGC
GCCGGCCGCTGATCATGCCGCACGAAATCACCCAGTCGATGCGAAAGGACGAACAGATCATCATCGTCCA
GGGCCACAGCCCGATTCGCTGCGGGCGCGCGATCTACTTCCGGCGGAAGGACATGAACGAGGCGGCGAAG
GCCAATCGCTTCGTCAAGGCGATTCCTTGA
 Primer design