SecReT4
Protein ID: 16263162
T4SS name [ID]VirB [196]
Gene symbolvirB11
Locus tagSMa1302
StrainSinorhizobium meliloti 1021
Repliconplasmid pSymA [GenBank: NC_003037] [Browse all T4SS(s) in this replicon]
Location [Strand]711238..712227 [-]
ProductVirB11-like ATPase
Component typeVirB11
UniProt IDQ92Z03
KEGG IDsme:SMa1302
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.6e-82, Aligned region: 16..316
AAA_18 [PF13238], Evalue: 2.3e-05, Aligned region: 166..209
AAA_17 [PF13207], Evalue: 4.2e-05, Aligned region: 166..198
Protein Sequence: 329 a.a.     [Download]
>gi|16263162|ref|NP_435955.1| VirB11-like ATPase [Sinorhizobium meliloti 1021]
MTEGADATVVRELLSPFAPFLGDRSLYEVIVNRPGQVLTEGAGGWRTYDLPELSFEKLMRLARAVASFSH
QSIDETRPILSATLPGDERIQIVIPPATTRNTVSITIRKPSSVTFTLNDLKEREFFSETRSANDGASTRD
DGLLALYRAGRFKEFLRHAVISRKNIIISGATGSGKTTLSKALIKHIPEHERIISIEDTPELIIPQPNHV
RLFYSKGAQGLSGAGPKELLESCLRMRPDRILLQELRDGTAFYYVRNVNSGHPGSITTVHADSAKLAFQQ
LTLLVKESAGGRNLDRDDIDKLLKVSIDVIVQCKRIDGRFRATEIYVRA
 
Nucleotide Sequence: 990 bp     [Download]
>gi|16262453|ref|NC_003037.1|:c712227-711238 Sinorhizobium meliloti 1021 plasmid pSymA, complete sequence
ATGACCGAAGGTGCCGACGCAACGGTCGTTCGTGAACTGCTCTCTCCGTTCGCGCCGTTCCTCGGTGACA
GGTCGCTCTACGAAGTGATCGTAAACCGGCCCGGGCAAGTGCTGACGGAAGGCGCTGGTGGTTGGCGGAC
CTATGACCTGCCGGAGCTTTCCTTCGAGAAGCTGATGCGCCTTGCCCGGGCAGTTGCCAGTTTTTCCCAC
CAATCAATTGATGAAACGCGACCGATCCTATCGGCAACCCTGCCCGGGGACGAACGCATCCAGATCGTCA
TCCCGCCAGCCACCACCAGGAACACGGTCAGCATCACCATCCGCAAGCCATCGTCGGTCACATTCACCCT
CAATGATCTGAAAGAGAGAGAGTTTTTCTCAGAGACGCGATCGGCCAACGACGGCGCCTCGACCCGGGAC
GACGGCTTGCTGGCGCTTTACCGTGCCGGCCGCTTCAAGGAATTTTTGCGGCACGCCGTCATTTCACGGA
AGAACATCATCATCTCAGGCGCAACCGGTTCGGGCAAGACGACTCTCTCGAAAGCGCTGATTAAACACAT
TCCCGAGCATGAGCGGATCATTTCGATCGAGGACACACCCGAACTCATTATTCCGCAGCCCAACCACGTG
CGCCTATTCTATTCGAAGGGTGCCCAGGGACTCTCGGGGGCTGGCCCCAAAGAGCTGCTCGAATCCTGTC
TCCGGATGCGGCCGGACCGAATTTTGCTGCAGGAACTGCGCGATGGCACGGCATTCTACTACGTTCGCAA
CGTCAACTCCGGTCACCCCGGATCGATAACTACCGTGCATGCCGATTCTGCCAAACTCGCCTTCCAACAG
TTAACGCTTCTCGTGAAGGAATCGGCAGGGGGACGGAATCTGGACCGTGATGACATCGATAAATTACTGA
AGGTATCAATCGACGTAATTGTTCAATGCAAGCGAATAGATGGGCGATTTCGTGCAACAGAAATCTACGT
TCGAGCCTAA
 Primer design